Paramormyrops kingsleyae: 111849456 Help Entry 111849456         CDS       T05788                                  Name (RefSeq) ras-related protein M-Ras-like   KO K07831   Ras-related protein M-Ras Organism pki  Paramormyrops kingsleyae Pathway pki04010   MAPK signaling pathway pki04137   Mitophagy - animal pki04140   Autophagy - animal pki04218   Cellular senescence pki04371   Apelin signaling pathway pki04625   C-type lectin receptor signaling pathway pki04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:pki00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     111849456    04371 Apelin signaling pathway     111849456  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     111849456    04137 Mitophagy - animal     111849456   09143 Cell growth and death    04218 Cellular senescence     111849456   09142 Cell motility    04810 Regulation of actin cytoskeleton     111849456  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     111849456  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:pki04031]     111849456 GTP-binding proteins [BR:pki04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     111849456 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras RsgA_GTPase GTP_EFTU DUF6352 Roc Arf MMR_HSR1_Xtn Motif Other DBs NCBI-GeneID:  111849456 NCBI-ProteinID:  XP_023678097 Ensembl:  ENSPKIG00000004834 LinkDB All DBs Position Unknown AA seq 133 aa AA seqDB search MREQYMRTGDGFLIVFSVTDKASFEHVDRFHQLILRVKDRESFPMVLVANKVDLVHLRKV TTEQGREMAAKHSITYIETSAKDPPMNVDKAFHELVRVIRQEIPEKSQKKKKKKAKWRGD RSTGSHRLRCVIL NT seq 402 nt NT seq  +upstreamnt  +downstreamnt atgcgagagcagtacatgcgcacaggtgacggcttcctcatcgtcttctccgtgacagac aaggccagcttcgagcatgtggaccgattccaccagctgatcttgcgtgtgaaggacagg gagtccttccccatggtcctggtggccaacaaggtggacctggtgcacctgaggaaggtg acgactgagcagggcagggagatggcggccaagcacagtattacatacatcgaaacgagt gccaaagaccctcccatgaatgtggacaaagcatttcatgagctggtcagagtgatcagg caggaaatcccagagaagagccagaagaagaagaaaaagaaggccaagtggcgtggggac aggtccaccggctctcaccggctccgctgtgtcattttgtga

DBGET integrated database retrieval system