KEGG   Pipistrellus kuhlii (Kuhl's pipistrelle): 118714148
Entry
118714148         CDS       T07682                                 
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
pkl  Pipistrellus kuhlii (Kuhl's pipistrelle)
Pathway
pkl04927  Cortisol synthesis and secretion
pkl04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:pkl00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    118714148
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    118714148
SSDB
Motif
Pfam: MRAP
Other DBs
NCBI-GeneID: 118714148
NCBI-ProteinID: XP_036284979
LinkDB
Position
Unknown
AA seq 145 aa
MAMANSSNASAPAYEYYLDYLDLLPVDERQLGAHKYSVVIAFWASLAAFVVLLFLVLLSM
SRPAPAARSHAPPRPACPWSLHVSLPFCIRRHPLLHSAPQRAPPSSAREPGSSASGPSAS
PPTTPQAHPALLWEQALDGDPHGIS
NT seq 438 nt   +upstreamnt  +downstreamnt
atggccatggccaacagcagcaacgcctcggcgcccgcctacgagtactacctggactac
ctggacctgctccccgtggacgagaggcagctgggggcccacaagtactccgtggtgatc
gccttctgggccagcctggccgccttcgtggtgctcctcttcctcgtcctgctctccatg
tcccgcccggctcccgcggccaggagccacgccccgccccgccctgcgtgtccctggagc
ctccacgtcagcctccccttctgcatccggaggcacccgctgctccacagcgccccccag
cgggccccgcccagctcagccagggagccaggcagcagtgcctccgggccctccgcctcg
ccccccaccaccccgcaggcccacccagctctcctgtgggagcaggccctggacggggac
ccccacggcatcagctga

DBGET integrated database retrieval system