KEGG   Pipistrellus kuhlii (Kuhl's pipistrelle): 118731636
Entry
118731636         CDS       T07682                                 
Symbol
ITGAX
Name
(RefSeq) integrin alpha-X
  KO
K06462  integrin alpha X
Organism
pkl  Pipistrellus kuhlii (Kuhl's pipistrelle)
Pathway
pkl04610  Complement and coagulation cascades
pkl04810  Regulation of actin cytoskeleton
pkl05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:pkl00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    118731636 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    118731636 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    118731636 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:pkl04515]
    118731636 (ITGAX)
   04090 CD molecules [BR:pkl04090]
    118731636 (ITGAX)
Cell adhesion molecules [BR:pkl04515]
 Integrins
  Integrin alpha subunits
   118731636 (ITGAX)
CD molecules [BR:pkl04090]
 Proteins
  118731636 (ITGAX)
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 FG-GAP_3 VWA_CoxE Integrin_alpha
Other DBs
NCBI-GeneID: 118731636
NCBI-ProteinID: XP_036316234
LinkDB
Position
Unknown
AA seq 1161 aa
MTRTWTRTSLLLLMGVASSLCFNLDTDKPTIFPMHSAGFGHTVVQYANWVVVGAPQEVKA
VNQTGGLYRCDYSTARCEPIQLQVPPEAVNMSLGLSLTAATTPSRLLACGPTVHHACNKN
MYLNGFCFLWAFSSWQAQRLPADLQECPRQEQDIVFLIDGSGSIRYSDFNKMLSFAKAVM
SQFQRPMTQFSLMQFSSSFRVHFTFRDFRQSSDPQQLLDSVHQLKGYTYTASAILKVIRE
LFSVHNGARADASKILIVITDGKKMGDSLEYKDVISEAEDKGIIRYAVGVGSAFKDKSSF
EELIAIASMPWTEHILRVDNFDALRDIQEQLKEKIFAIEGTHPVSSSAFELEMSQEGFSA
VLMPEGPVLGAVGSFGWSGGAFLYPQNMKPTFINMSQENVDMADSYLGYSAELALWKGVQ
SLVLGAPRHQHTGKAVLFTREAGQWRPKAEVPGAQIGSYFGASLCSVDVDRDGSSDLVLV
GAPHYYEPTRGGRVSVCPLPRGRARWQCQAVLRGEQGHPWGRFGAALTALGDVNGDKLAD
VAIGAPGEQESRGAVYLFHGTSGLGISPAHSQRIEGSQLSPRLQHFGQSLSGGQDLTMDG
LVDLAVGAQGHALLLRTRPVLRVWVDIHTTPTEIARSVFECREHSASIRDLADARVCLRV
HESPRTRLGNLQSDVTFHLTLDSGRLSPRAIFKETNNQHLTRGRLLGLGQHCEEVKLLLP
ACVEDSMIPITLSLNFSLVGKPILSLGNLQPMLAPDTPKHYTASLPFEKNCGDDHVCQDD
LGITIDASGLETLVVGSDLELSLGVKVWNTGEDSYGTTVTFSYPPGLSYRRVAVSQSRPQ
FHSLSLACDSALSGSQDAWSTSCSLRHIIFREGAQVTFVATFHVSPKASLGDRLLLTANV
SSENNTPRTSRTSSWLELPVKYAVYAVITSHEDSTKYLNFSASEEAGSRGAQLRYQVNNL
GQRDLPVSIHLWVPVELNQEAVWSALELLHPQNPSMRCSSERTEPTEPSPRAHVQKNSVL
DCSAAACQRFRCDVPSFGVQEELDFILKGNLSFGWVSQTLQKKVSVVSVAEVTFDTSVFT
QLPGQEALLRAQAEVVLEKQEVHNPVPLIVGSSVGGLLLLALITFLLYKAGFFKRQYKEM
MAEASGQAAPGNGPSDPQGDQ
NT seq 3486 nt   +upstreamnt  +downstreamnt
atgaccaggacctggaccaggacatcccttctcctgctgatgggcgtggcttcctctctc
tgcttcaacttggacacggacaagccgaccatcttccccatgcatagcgccgggtttgga
cacactgtggtccagtatgccaactgggtggtggtgggggccccccaggaggtaaaggct
gtcaaccaaacgggcggcctctaccggtgtgactacagcacggccagatgtgagcccatc
cagctgcaggtacccccggaggctgtgaacatgtccctgggcctgtccctgacagctgct
accacaccctctcggctgctggcctgtggccccactgtgcaccatgcatgcaacaagaac
atgtacttgaatgggttctgcttcctgtgggccttctcttcctggcaggcccagaggctc
ccagctgacctgcaggagtgcccgaggcaggagcaggacatcgtgttcctgatcgacggc
tcaggcagcatcagatatagtgattttaacaagatgctgagctttgcgaaagctgtgatg
agccagttccagagacccatgacccagttctccctgatgcagttctccagctccttccgg
gttcacttcacgttcagggacttcaggcagagctcagatccacaacagctgttggactct
gtgcaccagctgaaggggtacacgtacacggcctcagctatcctgaaggtcataagggag
ctgttcagtgtccacaatggggcccgagcggatgcctccaagatcctcatcgtcatcact
gatgggaagaaaatgggcgacagcctggaatacaaggacgtcatctccgaggcggaggac
aagggcatcatccgctatgcggtcggggtggggtcggcttttaaggacaagagctccttt
gaagaactgatagccatcgcgtccatgccctggaccgagcacatactccgagtggacaac
tttgatgctctgagggacattcaagagcagctgaaagagaagatctttgccattgagggg
acgcaccccgtgagcagcagcgccttcgagttggagatgtcccaggaaggcttcagcgcg
gtgctcatgcctgaaggacccgttctaggcgctgtggggagcttcggctggtctggaggt
gccttcctgtacccccaaaatatgaagcccaccttcatcaacatgtcccaggagaatgtg
gacatggcggactcctacctgggttactccgcggagctggccctttggaagggggtgcag
agcctggtcctgggggccccccgccaccagcacaccgggaaggccgtcctcttcacgcgg
gaggccgggcagtggaggccgaaggctgaggtcccaggggcccagattggctcctacttc
ggggcctccctctgctccgtggacgtggacagagatggcagctccgacctggtcctcgtc
ggggctccccactactacgagccgacccgggggggccgggtgtctgtgtgcccgttgccc
cgggggagggccaggtggcagtgccaggccgtgctccgcggggagcagggccacccctgg
ggccgctttggggcggccctgaccgcgctgggggacgtgaacggggacaagctggcggac
gtggccatcggggccccgggggagcaggagagccggggagccgtgtacctgttccacgga
acatcggggctgggcatcagccccgcccacagccagaggatcgaaggctcccagctctcc
cccaggctccagcacttcgggcagtcgctgagcggggggcaggacctcaccatggacggc
ctcgtggacctggccgtgggggcccaggggcatgcactgctgctcaggaccaggcctgtg
ctcagggtgtgggtggacatccacacgacacccactgagatcgcgaggtccgtgttcgag
tgtcgggagcactcagcctccatccgggacctggccgatgcccgcgtctgccttcgcgtg
cacgagagtcccaggacgcggctgggcaacctccaaagtgatgtgacctttcacctgacc
cttgactctggccgcctgagtccccgtgccatcttcaaggagacaaacaatcagcatctg
actcgtggtagactcctcggcctgggccagcactgtgaggaagtgaagctgctgctcccg
gcttgcgtggaggactcgatgattcccatcaccctgagtctcaatttctccctggtgggc
aagcccatcctttcccttgggaacctccagcccatgctggctccggacacccccaaacac
tacacggcctctctcccctttgagaagaactgtggagacgaccatgtctgccaggacgac
cttggcatcaccattgacgcctctggcttggagaccctggtggtggggagcgacctggag
ctgagcctgggagtgaaagtgtggaacaccggagaggactcctacgggaccaccgtcacc
ttctcctacccgcccgggctgtcctaccggcgtgtggcagtgagccagagccggccgcag
ttccactccctgagcctggcctgcgacagcgccctctcgggcagccaggacgcctggagc
accagctgcagcctcagacacatcatcttccgcgagggcgctcaggtcaccttcgtggcc
accttccacgtctcccccaaggcctcgctgggcgaccggctgctgctgacggccaatgtg
agcagcgagaacaacacgcccaggaccagcaggaccagctcctggctggagctcccggtg
aagtacgccgtctatgccgtgatcaccagccatgaggactccaccaagtacctcaacttc
tcggcctccgaggaggcggggagccgcggggcccagctccggtaccaggtgaacaacctg
ggacagagggacctgccggtcagcatccacctctgggtgccggtggagctgaaccaggaa
gccgtgtggtcagcgctggagctcctccacccccagaacccatcgatgcgctgctcctca
gagagaacggagcccacagagcccagcccccgggcccatgtccagaagaattctgtgctg
gactgctccgcggccgcctgccagaggttccgctgtgacgtcccctccttcggcgtccag
gaggaactggacttcatcctgaagggcaacctcagcttcggctgggtcagccagactctg
cagaagaaggtgtcggtggtgagcgttgcggaggtcacgttcgacacatccgtgttcact
cagctcccgggccaggaggcgcttctgagagcccaggcggaggtggtgctggaaaagcag
gaggtgcacaaccccgtgcccctcattgtgggcagctctgtgggcggactgctgctgctg
gctctcatcacgttcctgctgtacaaggccggcttctttaaacgccagtacaaagagatg
atggcggaagcaagtggacaagctgccccgggaaatgggccatcggacccccaaggcgac
caatga

DBGET integrated database retrieval system