Psychrobacter sp. KH172YL61: PKHYL_34450 Help Entry PKHYL_34450       CDS       T08351                                  Name (GenBank) hypothetical protein   KO K03608   cell division topological specificity factor Organism pky  Psychrobacter sp. KH172YL61 Brite KEGG Orthology (KO) [BR:pky00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pky03036]     PKHYL_34450   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pky04812]     PKHYL_34450 Chromosome and associated proteins [BR:pky03036]  Prokaryotic type   Chromosome partitioning proteins    Inhibitors of FtsZ assembly     PKHYL_34450 Cytoskeleton proteins [BR:pky04812]  Prokaryotic cytoskeleton proteins   MinD / ParA class of bacterial cytoskeletal proteins    PKHYL_34450 SSDB OrthologParalogGFIT Motif Pfam:  MinE Motif Other DBs NCBI-ProteinID:  BBI69254 LinkDB All DBs Position 2644942..2645079 Genome browser AA seq 45 aa AA seqDB search MKREILEVVNKYVNGVQIDDVNINHRSEDSLDVLEMNINLPEHKK NT seq 138 nt NT seq  +upstreamnt  +downstreamnt atgaaacgtgaaatcttagaagtggtcaacaaatatgtgaatggcgtgcagattgatgat gtcaatatcaatcatcgctcagaagacagcttagatgtgttagagatgaacattaattta ccggaacacaaaaaataa

DBGET integrated database retrieval system