KEGG   Pichia kudriavzevii: C5L36_0D03820
Entry
C5L36_0D03820     CDS       T06133                                 
Name
(RefSeq) uncharacterized protein
  KO
K06663  DNA damage checkpoint protein
Organism
pkz  Pichia kudriavzevii
Pathway
pkz04111  Cell cycle - yeast
pkz04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:pkz00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    C5L36_0D03820
   04113 Meiosis - yeast
    C5L36_0D03820
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pkz03400]
    C5L36_0D03820
DNA repair and recombination proteins [BR:pkz03400]
 Eukaryotic type
  Check point factors
   Rad17-Mec3-Ddc1 complex
    C5L36_0D03820
SSDB
Motif
Pfam: Rad1
Other DBs
NCBI-GeneID: 40385479
NCBI-ProteinID: XP_029323127
LinkDB
Position
4:complement(776443..778182)
AA seq 579 aa
MPFRFELELKAKSSRALWTRAIGALHTISDSLKIDIRQGTETGHDEQGRRCYSELVFSSM
NKTKTSVMKISFKECFFRMFRIEGEITDNVTRTMTNVENYAKNYSLIINSRDMNTLFKDC
ADDAESWKIFLIAGNEISQMIYSNRLFVEFETKAGLKKKYSVSYRPSMFGCDSKISFIYL
KTLENQRLSDEQEERGVLEDDGFDLLEEEEDERVHRIAINTLILKRFIQVFPQQIEDFRL
EIRPKEKSLVLIGYNRQNIIGRGDSVVNKPMNLSIQIQLNQIAYNNVREYKEDRDIKDIQ
VSFRLRNFKMFIQLISTGFTGFNSDDDNTKSNKRSRTISSYDRGFSNDYEDNICDIIFSK
SGYPIIFEKKYFTDGDNEILECCSISLTEVTDGESSRIILEAMNAAVNQKIRDLTSASGH
RQSLSALEALPTVKGNIWKQFTNAELAMPLSNRQDDHPVAVKEPLFVPDDDLHAVEYPQD
LVVPESVDNDVLSDASRGGDVGDYQQIFWEDERFHQTRVVEKPGFKKDRIDATVEHDMVH
GKNKRRLLTEEEPVGDDGVACQENYLGPTQKLQIKGLFD
NT seq 1740 nt   +upstreamnt  +downstreamnt
atgccttttcgatttgaattagagcttaaggcaaaaagttcaagagcattatggaccaga
gctattggagctttacatacaatttcagacagtttgaaaattgatattcgacaaggcacc
gagacaggacacgatgaacaaggacgacggtgttattcagaactggttttctcaagtatg
aataaaacaaaaaccagtgttatgaaaatatcattcaaagaatgttttttcagaatgttt
agaatcgaaggagagatcactgataatgtgacacgtacaatgacaaacgttgaaaactat
gctaaaaactattcattgattatcaacagtcgagacatgaacacattatttaaggattgt
gcggatgatgcagaaagctggaaaatatttctcatagcagggaacgaaatatcacaaatg
atttattcgaatagactatttgtagagtttgaaacaaaagcagggttgaagaaaaaatat
tcagtttcttacagaccttcaatgtttgggtgtgatagtaaaattagtttcatatacttg
aaaacactagaaaatcaaagactttctgatgaacaggaagagcgaggtgtgttggaagat
gatgggttcgatcttttggaggaggaggaggatgaacgcgtgcataggatagcaatcaac
acacttatattgaaacgctttatacaggtgtttcctcaacaaatagaagattttcggctc
gaaatacgccctaaggagaaaagccttgtccttatagggtacaataggcagaacataata
ggtagaggagattcagttgtgaacaagccaatgaacttgagtattcaaatacagttaaac
cagattgcatataataacgtacgtgaatataaagaagaccgagatatcaaggatatacaa
gtttcattccgactcaggaatttcaaaatgtttatacagttgataagtaccggttttacg
ggattcaatagcgatgatgataatacgaagtccaataaaagatcaagaactatttcaagc
tatgaccgtgggttctctaatgattatgaagataatatatgtgacataatcttctccaaa
tctgggtatcccattatttttgaaaaaaagtatttcactgacggtgataatgaaatcctg
gaatgctgttcgatttcattaaccgaagtaacggatggagaatcgtcgagaataatactc
gaagccatgaatgcggctgtcaatcagaaaatcagagatcttacatcggcttccgggcac
agacaatctctatctgcgttagaagcgttacctacagtaaagggaaatatatggaaacaa
ttcaccaatgctgaattggccatgcctctatcgaaccgtcaggatgatcatccggttgca
gttaaggagccattgtttgtaccggatgatgatctccacgctgtggagtatccacaagac
ctggttgttcctgagtcagtagacaatgacgtgttgtcagatgccagccgtgggggggac
gtaggagattaccaacagatattctgggaagatgaacggtttcatcagacacgtgttgtt
gaaaagcccggttttaagaaggaccgaatcgatgccaccgttgaacacgatatggtacat
ggcaagaacaagagacgtctcttaacggaggaagaacctgttggggacgacggagtggca
tgccaagaaaattaccttgggcctacccaaaaattacaaatcaaaggtttgtttgattaa

DBGET integrated database retrieval system