KEGG   Peromyscus leucopus (white-footed mouse): 114698449
Entry
114698449         CDS       T07241                                 
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
pleu  Peromyscus leucopus (white-footed mouse)
Pathway
pleu04927  Cortisol synthesis and secretion
pleu04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:pleu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    114698449
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    114698449
SSDB
Motif
Pfam: MRAP
Other DBs
NCBI-GeneID: 114698449
NCBI-ProteinID: XP_028732975
LinkDB
Position
12:complement(7997516..8010302)
AA seq 168 aa
MSSLGPTHSPAPDVRLWQTPASTATVMANRTNASVPYTSYEYYLDYLDLIPVDEKKLRAN
KHSIVIAFWVSLATFVVLLFLILLYMSWSGSPQMRHRPQPHRICPWSHSLDLPFCPRRAS
PQTTEEPGSRTGSEQWLQQQSPSASPLEPGLGWGFPGHQLTSGTSKGV
NT seq 507 nt   +upstreamnt  +downstreamnt
atgtcgtccctggggcccacacacagcccagctccggatgtgaggctctggcagacaccg
gcctccacagccacagtcatggccaacaggaccaacgcctccgtcccgtacaccagctat
gaatattacctggattacttagacctcattcctgtggatgaaaagaagctgagagccaac
aagcattccatcgtcatcgccttttgggtgagcctggcaactttcgtggtgctcctcttc
ctgattctgctctacatgtcctggtcaggctccccgcagatgagacacaggccccagccc
catcggatatgcccatggagtcacagcctcgacctccccttctgccccaggagggcctcc
ccgcagacaacagaggaaccaggaagcagaactggctctgagcaatggttacagcagcag
agtccctctgcctcgcccctggaaccaggcttgggatggggcttcccagggcatcagctg
acctcaggcacaagcaagggggtgtag

DBGET integrated database retrieval system