KEGG   Peromyscus leucopus (white-footed mouse): 114704405
Entry
114704405         CDS       T07241                                 
Name
(RefSeq) LOW QUALITY PROTEIN: integrin alpha-X-like
  KO
K06462  integrin alpha X
Organism
pleu  Peromyscus leucopus (white-footed mouse)
Pathway
pleu04610  Complement and coagulation cascades
pleu04810  Regulation of actin cytoskeleton
pleu05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:pleu00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114704405
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    114704405
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    114704405
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:pleu04515]
    114704405
   04090 CD molecules [BR:pleu04090]
    114704405
Cell adhesion molecules [BR:pleu04515]
 Integrins
  Integrin alpha subunits
   114704405
CD molecules [BR:pleu04090]
 Proteins
  114704405
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 FG-GAP_3 VWA_CoxE FG-GAP_2
Other DBs
NCBI-GeneID: 114704405
NCBI-ProteinID: XP_028741481
LinkDB
Position
1:complement(76474417..76493770)
AA seq 965 aa
MSTWTALLLLMAFVSSLGFNLDTDKPTHFHVDGAGFGHSVVQYDGSWVVVGAPKEVRATN
QMGGLYQCGYHTGTCDPVRLQVPPAAVNMSLGLSLTATANPPRLLACGPTVHHTCRENIY
LTGLCFLLASSMLQNQRILTAQQECPKQDQDIVFLIDGSGSISSDNFKTMLNFVEAVMSQ
FQGSSTQFSLMQFSDRFETHFTFKHSTSRPLDLLIRVRQLRGFTHTASAIEHVTTQLFTA
RNGARKDATRILVVITDGKKEGDKRDYGDVIPLADAAGIIRYAIGVGRAFHTVQSQQELE
NIASKPSREHIFSVENFDALKDIQKQLKEKIFAIEGTETASSSSFELEMSQEGFSAVFTP
GGPVLGAVGSFGWSGGAFLYPPNMRPTFINMSQENVDMRDAYLGYSTALAFWKGVHSLVL
GAPRHQHTGKVVIFTQKSRRWRPKSEVSGTQIGSYFGASLCSVDMDRDGSTDLVLIGAPH
YYEQTRGGQVSVCPMPSGRIRWQCEATLHGEQGHPWGRFGAALTVLGDVNGDSVTDVAIG
APGEEENRGAVYIFHGASKLDINPSPSQRISGSQLFPRLQHFGQSLSGGQDLTQDGLADL
AVGSKGRVLLLRTRPILRMLSTIHFSPAEIARSVFECQEQVTSVQTLGDATVCLQVYESP
KTQLGDLQSSVTFDLTLDPGRLSPRAVFKETKTQALTRVKTLGLSKYCETVKLLLPACVE
DSVTPITLRLNFSLVGLPIPSYRNLQPMLAVDEQTYFTASLPFEKNCGADHICQDDLGII
FGFPDLKTLAVGSDLELDVGVTVSNDGEDSYGTTVTLLYPVGLSFRRVAGGQVLYRGTEE
NQRRQRALHLTCDSTPSRSQGLWRTSCRISHIIFRGGAQMTFLVTFDVSPKAALGDRLLL
TAKVSSENDTPETKKTTFQLELPVKYAVYTVISSHDQSTKYLNFSASGKEKSSVAEHRYQ
ASVGT
NT seq 2898 nt   +upstreamnt  +downstreamnt
atgagcacttggacagcccttcttctgctgatggcatttgtttcgtctctgggcttcaac
ctggacacagacaagccgacacatttccatgtggatggtgctgggttcggacacagtgtg
gtccagtatgacggctcctgggtggtggttggagctccaaaggaggtcagggccactaac
caaatgggtggcctctaccaatgtggctatcacacgggcacgtgtgatcctgtccgtctc
caggtgcctccagcagctgtgaacatgtccctgggcctgtccctcactgccaccgccaac
cctcccaggctgttggcctgtggtcctactgtgcaccacacatgcagagagaatatatac
ttgacgggactctgctttctactggcctcatcaatgctgcagaaccaaaggatcctgact
gcccagcaggagtgtccaaagcaggaccaggacatcgtgttcttgattgatggttcgggt
agcatctcttccgacaactttaaaacaatgctgaattttgtggaagctgtgatgagccaa
ttccaaggatccagcacacagttctccctgatgcaattctccgatcgatttgagacacat
tttactttcaaacactccacttcgagacctttagacctgttgatccgcgtacggcagctg
agagggttcacacacacggcctcggctattgagcatgtcacaacgcagctgttcactgcc
cgaaatggggcccggaaagatgccaccaggatcctcgttgtcattactgatggaaagaag
gaaggagacaagcgggattatggtgacgtcatccccctggcagatgctgcgggcatcatt
cgttatgcaattggggtaggacgggcctttcacacggtacaatcccagcaagagttagag
aacattgcgtcgaagccttcccgagaacacatcttcagcgtggagaactttgacgctttg
aaggacattcagaagcagctgaaggagaagatctttgccattgagggtacggagacagca
agcagcagttcttttgaactggagatgtcccaggagggcttcagtgctgtatttacacct
ggtgggccagttctgggagctgtgggaagcttcgggtggtctggaggtgccttcttatac
cccccaaatatgagacccaccttcatcaacatgtctcaggagaatgtggacatgagggac
gcttacctgggttactccaccgcactggccttttggaagggggtccacagcctggtcctg
ggggcccctcgccaccagcacacggggaaggttgtcatctttacccagaaatccaggcga
tggaggcccaagtctgaagtcagtgggacacagatcggctcctactttggggcctccctc
tgctctgtggacatggatagagatggcagcactgacctggtcttgatcggagccccccat
tactatgagcagacccgaggggggcaggtatctgtgtgcccaatgcccagcgggaggatc
aggtggcagtgtgaggccacgctccatggggagcagggccatccttggggccgctttggg
gcagccctgacagtgctaggggacgtgaatggggacagtgtgacagatgtggctattggt
gcacctggagaggaagagaacaggggtgctgtgtacatatttcatggagcctcgaaactg
gacatcaacccctcgcccagccagaggatttcaggatcccagctcttccccaggctccag
cattttgggcagtcactgagtgggggtcaggacctcacccaggatggactggcggacctg
gctgtgggatctaagggacgggtgctgctgctcaggaccaggccgatccttcgaatgtta
tcgactatacacttctcacctgcagagatcgccaggtctgtgtttgagtgtcaggagcag
gtgacctctgtccagacactgggagatgccactgtctgccttcaagtttatgaaagcccc
aagacccagctgggtgacctccaaagctctgtcacctttgacctgaccctagaccctggc
cgcctgagtcctcgtgccgtcttcaaggaaacaaagacccaagctctgacccgagttaaa
actcttggtctgagcaagtactgtgaaaccgtgaagttgctcctcccggcctgtgtggag
gactcagtgacccccatcactttgcgcctcaacttctctcttgttggcttgcccatccct
tcctaccgaaaccttcaacccatgctggctgtagatgagcaaacgtacttcacggcctct
cttccctttgagaagaactgtggagctgatcacatctgccaggatgaccttggcatcatc
tttggcttcccagacttgaagaccctggcggtgggaagtgacctggagctggatgtgggt
gtgacagtgtctaacgatggggaagactcctatggaaccacagtcactttgctctaccca
gtgggcctgtccttcagacgagtcgcaggaggccaagtactctaccgggggacggaagag
aaccaacggcggcagcgtgccctgcacctcacatgtgacagcactccaagcaggagccag
ggcctctggaggaccagttgccgcatcagccacatcattttccgaggaggtgcacagatg
actttcttggtaacttttgatgtctccccgaaagctgcgctgggggaccggctgcttcta
acagccaaagtgagcagtgagaatgacacacctgagaccaaaaaaaccaccttccagctg
gagctcccagtaaagtatgctgtgtacacggtgatcagcagccacgaccagtctaccaag
tatctcaacttctcggcctcaggaaaggagaagagcagtgtggccgaacacagataccag
gcaagcgtggggacttag

DBGET integrated database retrieval system