KEGG   Perognathus longimembris pacificus (Pacific pocket mouse): 125353096
Entry
125353096         CDS       T08928                                 
Name
(RefSeq) calmodulin-1-like
  KO
K02183  calmodulin
Organism
plop  Perognathus longimembris pacificus (Pacific pocket mouse)
Pathway
plop04014  Ras signaling pathway
plop04015  Rap1 signaling pathway
plop04020  Calcium signaling pathway
plop04022  cGMP-PKG signaling pathway
plop04024  cAMP signaling pathway
plop04070  Phosphatidylinositol signaling system
plop04114  Oocyte meiosis
plop04218  Cellular senescence
plop04261  Adrenergic signaling in cardiomyocytes
plop04270  Vascular smooth muscle contraction
plop04371  Apelin signaling pathway
plop04625  C-type lectin receptor signaling pathway
plop04713  Circadian entrainment
plop04720  Long-term potentiation
plop04722  Neurotrophin signaling pathway
plop04728  Dopaminergic synapse
plop04740  Olfactory transduction
plop04744  Phototransduction
plop04750  Inflammatory mediator regulation of TRP channels
plop04910  Insulin signaling pathway
plop04912  GnRH signaling pathway
plop04915  Estrogen signaling pathway
plop04916  Melanogenesis
plop04921  Oxytocin signaling pathway
plop04922  Glucagon signaling pathway
plop04924  Renin secretion
plop04925  Aldosterone synthesis and secretion
plop04970  Salivary secretion
plop04971  Gastric acid secretion
plop05010  Alzheimer disease
plop05012  Parkinson disease
plop05022  Pathways of neurodegeneration - multiple diseases
plop05031  Amphetamine addiction
plop05034  Alcoholism
plop05133  Pertussis
plop05152  Tuberculosis
plop05163  Human cytomegalovirus infection
plop05167  Kaposi sarcoma-associated herpesvirus infection
plop05170  Human immunodeficiency virus 1 infection
plop05200  Pathways in cancer
plop05214  Glioma
plop05417  Lipid and atherosclerosis
plop05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:plop00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    125353096
   04015 Rap1 signaling pathway
    125353096
   04371 Apelin signaling pathway
    125353096
   04020 Calcium signaling pathway
    125353096
   04070 Phosphatidylinositol signaling system
    125353096
   04024 cAMP signaling pathway
    125353096
   04022 cGMP-PKG signaling pathway
    125353096
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    125353096
   04218 Cellular senescence
    125353096
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    125353096
  09152 Endocrine system
   04910 Insulin signaling pathway
    125353096
   04922 Glucagon signaling pathway
    125353096
   04912 GnRH signaling pathway
    125353096
   04915 Estrogen signaling pathway
    125353096
   04921 Oxytocin signaling pathway
    125353096
   04916 Melanogenesis
    125353096
   04924 Renin secretion
    125353096
   04925 Aldosterone synthesis and secretion
    125353096
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    125353096
   04270 Vascular smooth muscle contraction
    125353096
  09154 Digestive system
   04970 Salivary secretion
    125353096
   04971 Gastric acid secretion
    125353096
  09156 Nervous system
   04728 Dopaminergic synapse
    125353096
   04720 Long-term potentiation
    125353096
   04722 Neurotrophin signaling pathway
    125353096
  09157 Sensory system
   04744 Phototransduction
    125353096
   04740 Olfactory transduction
    125353096
   04750 Inflammatory mediator regulation of TRP channels
    125353096
  09159 Environmental adaptation
   04713 Circadian entrainment
    125353096
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    125353096
  09162 Cancer: specific types
   05214 Glioma
    125353096
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    125353096
   05163 Human cytomegalovirus infection
    125353096
   05167 Kaposi sarcoma-associated herpesvirus infection
    125353096
  09171 Infectious disease: bacterial
   05133 Pertussis
    125353096
   05152 Tuberculosis
    125353096
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    125353096
   05012 Parkinson disease
    125353096
   05022 Pathways of neurodegeneration - multiple diseases
    125353096
  09165 Substance dependence
   05031 Amphetamine addiction
    125353096
   05034 Alcoholism
    125353096
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    125353096
   05418 Fluid shear stress and atherosclerosis
    125353096
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:plop01009]
    125353096
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:plop04131]
    125353096
   03036 Chromosome and associated proteins [BR:plop03036]
    125353096
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:plop04147]
    125353096
Protein phosphatases and associated proteins [BR:plop01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     125353096
Membrane trafficking [BR:plop04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    125353096
Chromosome and associated proteins [BR:plop03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     125353096
Exosome [BR:plop04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   125353096
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_5 AIF-1 EF-hand_9 EF_EFCAB10_C EF-hand_FSTL1 EH UPF0154 EF-hand_11 SAPC2_N EF-hand_EFHB_C FCaBP_EF-hand EFhand_Ca_insen Dockerin_1 RNA_pol_Rpb4 SPARC_Ca_bdg DUF5580_M
Other DBs
NCBI-GeneID: 125353096
NCBI-ProteinID: XP_048204518
LinkDB
Position
6:36783162..36784285
AA seq 150 aa
MADQLTEEQIAEFKEAFSLFDKDGNGTITTKELGTVMRSLGQNPTEAELQDMINEVDEVV
GNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAEPRHVMTNLGEKLTD
EEVDEMIREADIDGDGQVNYEEFVQMMTAK
NT seq 453 nt   +upstreamnt  +downstreamnt
atggctgaccaactgactgaagagcagattgcagaattcaaagaagctttttcactattt
gacaaggatggtaatggaactataacaacaaaggaactgggaactgtaatgaggtctctt
gggcaaaatcccacagaagcagagttacaggacatgattaatgaagtagatgaagtagta
ggtaatggcacaattgactttcctgaatttctgacaatgatggcaagaaaaatgaaagac
actgacagtgaagaagaaattagagaagcattccgtgtatttgataaggatggcaatggt
tatattagtgcagcagagcctcgccatgtgatgacaaacctgggggagaagttaacagat
gaagaggttgatgaaatgatcagggaagcagatattgatggtgatggtcaagtaaactat
gaagagtttgtacaaatgatgacagcaaagtga

DBGET integrated database retrieval system