Pseudomonas maumuensis: KSS90_22830 Help Entry KSS90_22830       CDS       T07719                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism pmam  Pseudomonas maumuensis Pathway pmam02024   Quorum sensing pmam03018   RNA degradation Brite KEGG Orthology (KO) [BR:pmam00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     KSS90_22830 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     KSS90_22830 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pmam03019]     KSS90_22830 (hfq)    03036 Chromosome and associated proteins [BR:pmam03036]     KSS90_22830 (hfq) Messenger RNA biogenesis [BR:pmam03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      KSS90_22830 (hfq) Chromosome and associated proteins [BR:pmam03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     KSS90_22830 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  QXH56125 UniProt:  A0ABX8NJF6 LinkDB All DBs Position complement(5104985..5105245) Genome browser AA seq 86 aa AA seqDB search MSKGHSLQDPYLNTLRKEKVPVSIYLVNGIKLQGQIESFDQFVVLLKNTVSQMVYKHAIS TVVPARPVRLPSPTDGEHGDSEPGNA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgtcaaaagggcattcgctacaagacccttacttgaacaccttgagaaaagaaaaagtc ccggtttcgatctatctggtcaacgggatcaagctgcagggccagatcgaatccttcgac cagttcgtcgtgctgctgaaaaacaccgtcagccagatggtctacaagcacgccatttcg accgtcgtccccgcacgcccggttcgtctgccaagcccgaccgatggtgagcacggcgac agcgagccaggcaacgcttga

DBGET integrated database retrieval system