KEGG   Peromyscus maniculatus bairdii (prairie deer mouse): 102911961
Entry
102911961         CDS       T11302                                 
Name
(RefSeq) calmodulin-like protein 3
  KO
K02183  calmodulin
Organism
pmav  Peromyscus maniculatus bairdii (prairie deer mouse)
Pathway
pmav04014  Ras signaling pathway
pmav04015  Rap1 signaling pathway
pmav04020  Calcium signaling pathway
pmav04022  cGMP-PKG signaling pathway
pmav04024  cAMP signaling pathway
pmav04070  Phosphatidylinositol signaling system
pmav04114  Oocyte meiosis
pmav04218  Cellular senescence
pmav04261  Adrenergic signaling in cardiomyocytes
pmav04270  Vascular smooth muscle contraction
pmav04371  Apelin signaling pathway
pmav04625  C-type lectin receptor signaling pathway
pmav04713  Circadian entrainment
pmav04720  Long-term potentiation
pmav04722  Neurotrophin signaling pathway
pmav04728  Dopaminergic synapse
pmav04740  Olfactory transduction
pmav04744  Phototransduction
pmav04750  Inflammatory mediator regulation of TRP channels
pmav04910  Insulin signaling pathway
pmav04912  GnRH signaling pathway
pmav04915  Estrogen signaling pathway
pmav04916  Melanogenesis
pmav04921  Oxytocin signaling pathway
pmav04922  Glucagon signaling pathway
pmav04924  Renin secretion
pmav04925  Aldosterone synthesis and secretion
pmav04970  Salivary secretion
pmav04971  Gastric acid secretion
pmav05010  Alzheimer disease
pmav05012  Parkinson disease
pmav05022  Pathways of neurodegeneration - multiple diseases
pmav05031  Amphetamine addiction
pmav05034  Alcoholism
pmav05133  Pertussis
pmav05152  Tuberculosis
pmav05163  Human cytomegalovirus infection
pmav05167  Kaposi sarcoma-associated herpesvirus infection
pmav05170  Human immunodeficiency virus 1 infection
pmav05200  Pathways in cancer
pmav05214  Glioma
pmav05417  Lipid and atherosclerosis
pmav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pmav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102911961
   04015 Rap1 signaling pathway
    102911961
   04371 Apelin signaling pathway
    102911961
   04020 Calcium signaling pathway
    102911961
   04070 Phosphatidylinositol signaling system
    102911961
   04024 cAMP signaling pathway
    102911961
   04022 cGMP-PKG signaling pathway
    102911961
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102911961
   04218 Cellular senescence
    102911961
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102911961
  09152 Endocrine system
   04910 Insulin signaling pathway
    102911961
   04922 Glucagon signaling pathway
    102911961
   04912 GnRH signaling pathway
    102911961
   04915 Estrogen signaling pathway
    102911961
   04921 Oxytocin signaling pathway
    102911961
   04916 Melanogenesis
    102911961
   04924 Renin secretion
    102911961
   04925 Aldosterone synthesis and secretion
    102911961
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102911961
   04270 Vascular smooth muscle contraction
    102911961
  09154 Digestive system
   04970 Salivary secretion
    102911961
   04971 Gastric acid secretion
    102911961
  09156 Nervous system
   04728 Dopaminergic synapse
    102911961
   04720 Long-term potentiation
    102911961
   04722 Neurotrophin signaling pathway
    102911961
  09157 Sensory system
   04744 Phototransduction
    102911961
   04740 Olfactory transduction
    102911961
   04750 Inflammatory mediator regulation of TRP channels
    102911961
  09159 Environmental adaptation
   04713 Circadian entrainment
    102911961
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102911961
  09162 Cancer: specific types
   05214 Glioma
    102911961
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102911961
   05163 Human cytomegalovirus infection
    102911961
   05167 Kaposi sarcoma-associated herpesvirus infection
    102911961
  09171 Infectious disease: bacterial
   05133 Pertussis
    102911961
   05152 Tuberculosis
    102911961
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102911961
   05012 Parkinson disease
    102911961
   05022 Pathways of neurodegeneration - multiple diseases
    102911961
  09165 Substance dependence
   05031 Amphetamine addiction
    102911961
   05034 Alcoholism
    102911961
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102911961
   05418 Fluid shear stress and atherosclerosis
    102911961
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pmav01009]
    102911961
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pmav04131]
    102911961
   03036 Chromosome and associated proteins [BR:pmav03036]
    102911961
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pmav04147]
    102911961
Protein phosphatases and associated proteins [BR:pmav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     102911961
Membrane trafficking [BR:pmav04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    102911961
Chromosome and associated proteins [BR:pmav03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     102911961
Exosome [BR:pmav04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   102911961
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF-hand_FSTL1 EH EF_EFCAB10_C SPARC_Ca_bdg UPF0154 EFhand_Ca_insen EF-hand_EFHB_C SAPC2_N DUF5580_M EF-hand_11 Dockerin_1 RNA_pol_Rpb4 EF-hand_STIM1 FCaBP_EF-hand Caleosin DUF1103 SurA_N_3 EF-hand_SWAP70_N RFC1
Other DBs
NCBI-GeneID: 102911961
NCBI-ProteinID: XP_015863996
Ensembl: ENSPEMG00000005855
UniProt: A0A6J0E6L5
LinkDB
Position
5:complement(87915050..87916918)
AA seq 149 aa
MANQLTEEQIAEFKEAFSLFDKDGDGCITTQELGTVMRSLGQNPTEAELQGMVNEIDKDG
NGTVDFPEFLSMMSRKMKDSDSEEEIREAFRVFDKDGNGYVSAAELRHVMTRLGEKLSDE
EVEEMIRAADTDGDGQVNYEEFVHMLVSK
NT seq 450 nt   +upstreamnt  +downstreamnt
atggccaaccagctgactgaggagcaaatcgctgagttcaaggaggccttctctctgttt
gacaaggatggggatggatgcatcaccacccaggaactgggcacggtcatgcggtccctg
ggtcagaaccccacggaggctgagctccagggcatggtgaatgaaatcgacaaggatgga
aatggcaccgtggacttccctgagttcctgagcatgatgtccaggaagatgaaagacagt
gacagcgaggaagagatccgggaggccttccgggtgttcgacaaggatggcaatggttat
gtcagcgctgctgagctgaggcacgtgatgaccaggctcggggagaagctgagtgatgag
gaggtggaggaaatgatccgggcagcagatacagacggtgatggccaagtgaactatgag
gagtttgtccacatgctggtgtccaagtga

DBGET integrated database retrieval system