Ectopseudomonas mendocina NK-01: MDS_0382 Help Entry MDS_0382          CDS       T01473                                  Name (GenBank) hypothetical protein   KO K09892   cell division protein ZapB Organism pmk  Ectopseudomonas mendocina NK-01 Brite KEGG Orthology (KO) [BR:pmk00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pmk03036]     MDS_0382 Chromosome and associated proteins [BR:pmk03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     MDS_0382 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Matrilin_ccoil ZapB Asd-4 Motif Other DBs NCBI-ProteinID:  AEB56413 LinkDB All DBs Position complement(400813..401022) Genome browser AA seq 69 aa AA seqDB search MEDAELHALTAKLELLIQRVEQLKAHNRLLLANEQAWREERAHLIEKNELARHKVESMIS RLKALEQDS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaagacgccgaactgcacgcattgaccgccaagctggagctgctgatccagcgtgtc gagcagctaaaggctcacaaccgactcctgctggcgaatgaacaggcctggcgcgaggaa cgcgctcatctgatcgaaaagaacgaattggcccggcataaggtcgaatcgatgatttcg cgcctcaaagccctggagcaggactcatga

DBGET integrated database retrieval system