Petrotoga mobilis: Pmob_1381 Help Entry Pmob_1381         CDS       T00621                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism pmo  Petrotoga mobilis Pathway pmo02024   Quorum sensing pmo03018   RNA degradation Brite KEGG Orthology (KO) [BR:pmo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     Pmob_1381  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     Pmob_1381  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pmo03019]     Pmob_1381    03036 Chromosome and associated proteins [BR:pmo03036]     Pmob_1381 Messenger RNA biogenesis [BR:pmo03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      Pmob_1381 Chromosome and associated proteins [BR:pmo03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     Pmob_1381 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Motif Other DBs NCBI-ProteinID:  ABX32085 UniProt:  A9BHX0 LinkDB All DBs Position 1488908..1489150 Genome browser AA seq 80 aa AA seqDB search MAEKFNLQDRFLNILRINKIEVKIYLEGGFQTSGVVRSFDDYTVLLGKNGEQSLVYKHAV KMMVPSKYIKLFQEPPSKDE NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggcagaaaagttcaatttacaagaccgatttttgaatattttgaggattaacaagata gaagtaaaaatctatttagaagggggatttcaaacaagtggagtggtgagatcttttgat gattatactgttttgttgggaaaaaacggtgaacaatcactggtttataaacatgccgta aaaatgatggtaccttcgaaatatattaaacttttccaagaaccaccgtctaaagatgag tag

DBGET integrated database retrieval system