KEGG   Passer montanus (Eurasian tree sparrow): 120496500
Entry
120496500         CDS       T07277                                 
Name
(RefSeq) melanocortin-2 receptor accessory protein isoform X1
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
pmoa  Passer montanus (Eurasian tree sparrow)
SSDB
Motif
Pfam: MRAP PAG SelK_SelG MAP17
Other DBs
NCBI-GeneID: 120496500
NCBI-ProteinID: XP_039552929
LinkDB
Position
Unknown
AA seq 91 aa
MANGTNSSDYFWSYEYYWDYIDPIPVDGSKLKVNKYSIVIAFWVGLAAFVTFLFLVLLCM
SCSGSTPANTATNGSAGSSRSSLGCDCRRTN
NT seq 276 nt   +upstreamnt  +downstreamnt
atggctaacggaacaaactcctctgactatttctggtcttatgaatactactgggattac
atagatccaattccagtagatggaagcaagttgaaggttaataaatactccatcgtcatc
gccttctgggtgggcctcgctgccttcgtgacctttcttttccttgttctgctgtgtatg
tcctgctctggatccacgccagcaaacacggccacgaacgggagcgcggggtcgagcagg
agctctttaggctgtgactgcaggcgcactaattaa

DBGET integrated database retrieval system