Passer montanus (Eurasian tree sparrow): 120511595 Help Entry 120511595         CDS       T07277                                  Name (RefSeq) C-C motif chemokine 5-like   KO K12499   C-C motif chemokine 5 Organism pmoa  Passer montanus (Eurasian tree sparrow) Pathway pmoa04060   Cytokine-cytokine receptor interaction pmoa04620   Toll-like receptor signaling pathway pmoa04621   NOD-like receptor signaling pathway pmoa04623   Cytosolic DNA-sensing pathway pmoa05164   Influenza A pmoa05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:pmoa00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     120511595  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     120511595    04621 NOD-like receptor signaling pathway     120511595    04623 Cytosolic DNA-sensing pathway     120511595  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     120511595    05168 Herpes simplex virus 1 infection     120511595  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pmoa04052]     120511595    00536 Glycosaminoglycan binding proteins [BR:pmoa00536]     120511595 Cytokines and neuropeptides [BR:pmoa04052]  Cytokines   Chemokines    120511595 Glycosaminoglycan binding proteins [BR:pmoa00536]  Heparan sulfate / Heparin   Chemokines    120511595 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  120511595 NCBI-ProteinID:  XP_039584827 LinkDB All DBs Position Unknown AA seq 102 aa AA seqDB search MRVPAAAMAVLLLVAICSLAQADLRVSWIASPYENNARNTPCCYSYISRPVARRVIVSAY LTRENCPMPAVVLITRKGTQLCADPRANWVQKYLEDLMFWQY NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgagggtccctgcagctgccatggctgttctgctccttgtggccatctgctccctggct caggctgatctcagagtctcctggattgcttcaccttacgagaataatgccagaaacacc ccctgctgctactcctacatttcacgccccgttgcacgccgagtgatcgtctctgcctac ctgaccagggaaaactgcccaatgccagctgtggtcttgatcaccaggaaggggacgcag ctgtgtgcagaccccagagctaactgggtgcagaaatacctggaggacttgatgttttgg cagtactga

DBGET integrated database retrieval system