KEGG   Pseudomonas monteilii SB3078: X969_10810
Entry
X969_10810        CDS       T02972                                 
Name
(GenBank) short-chain dehydrogenase
  KO
K10617  p-cumic alcohol dehydrogenase
Organism
pmon  Pseudomonas monteilii SB3078
Pathway
pmon00622  Xylene degradation
pmon01100  Metabolic pathways
pmon01120  Microbial metabolism in diverse environments
pmon01220  Degradation of aromatic compounds
Module
pmon_M00419  Cymene degradation, p-cymene => p-cumate
Brite
KEGG Orthology (KO) [BR:pmon00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00622 Xylene degradation
    X969_10810
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase
Other DBs
NCBI-ProteinID: AHC82436
LinkDB
Position
2298412..2299170
AA seq 252 aa
MRLKDKVAIVTGAATGIGNAIVRSYLAEGAKVVIADVKGAEAAAAELGEDLALGVFADVS
DPDSTKQMAKAALDRFGKIDVLVNNAGIFTGLNYVPMESISVADWDKLYSVNVKGPWLCA
SAVSAAMREGGGGKIINIASVIAHIGAPFMLHYVSSKGAVAAMTRAMAREFATTKAGISV
NSISPGYTHSENALANAQQHEQFEGVSASMRAIDRPQVPADIAGVALWLASDEASYVNGQ
NIVVDGGIYMSL
NT seq 759 nt   +upstreamnt  +downstreamnt
atgagactgaaagacaaagtcgcaatcgtgactggtgcggcaaccgggattggcaacgct
atcgtgcgctcttaccttgctgagggtgcgaaggtggtcattgctgatgtgaaaggtgct
gaggcagccgcggcggaactgggtgaagacctagcgttgggtgtctttgccgacgtttcg
gatcctgatagcaccaagcagatggcaaaggcagcactggatcgcttcggcaagatcgac
gtgctcgtcaacaatgccggtatcttcaccggtctcaactatgtcccgatggaatcgatc
tcggttgcggattgggacaagctctacagtgtcaatgtcaaggggccctggctgtgcgcc
agtgcggtgtcggccgcgatgcgcgagggtggtggtggcaagatcatcaacatcgcctca
gtaatcgctcacatcggagcgcccttcatgttgcactacgtttccagcaagggcgctgtt
gcggcgatgacacgtgccatggcgcgcgaatttgcgacgaccaaggcagggatcagcgtc
aactccatctctcccggctacacccattcggaaaatgcgctcgcaaacgctcagcagcat
gagcagttcgagggcgtttctgcgtccatgcgggcaatcgatcgaccgcaagtgccggca
gatattgcgggagtggcgctttggttggctagcgacgaagcctcctacgtaaacgggcag
aacattgtggtggatggcggcatttacatgagcctctga

DBGET integrated database retrieval system