KEGG   Pseudomonas monteilii SB3078: X969_10950
Entry
X969_10950        CDS       T02972                                 
Name
(GenBank) 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase
  KO
K16269  cis-1,2-dihydrobenzene-1,2-diol/chlorobenzene dihydrodiol dehydrogenase [EC:1.3.1.19 1.3.1.119]
Organism
pmon  Pseudomonas monteilii SB3078
Pathway
pmon00361  Chlorocyclohexane and chlorobenzene degradation
pmon00362  Benzoate degradation
pmon00623  Toluene degradation
pmon00624  Polycyclic aromatic hydrocarbon degradation
pmon00643  Styrene degradation
pmon01100  Metabolic pathways
pmon01120  Microbial metabolism in diverse environments
pmon01220  Degradation of aromatic compounds
Module
pmon_M00547  Benzene/toluene degradation, benzene => catechol / toluene => 3-methylcatechol
Brite
KEGG Orthology (KO) [BR:pmon00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    X969_10950
   00361 Chlorocyclohexane and chlorobenzene degradation
    X969_10950
   00623 Toluene degradation
    X969_10950
   00643 Styrene degradation
    X969_10950
   00624 Polycyclic aromatic hydrocarbon degradation
    X969_10950
Enzymes [BR:pmon01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.19  cis-1,2-dihydrobenzene-1,2-diol dehydrogenase
     X969_10950
    1.3.1.119  chlorobenzene dihydrodiol dehydrogenase
     X969_10950
SSDB
Motif
Pfam: adh_short adh_short_C2 KR 3Beta_HSD Epimerase
Other DBs
NCBI-ProteinID: AHC82462
LinkDB
Position
2326572..2327399
AA seq 275 aa
MRLEGEVALVTGGGAGLGRAIVDRYVAEGARVAVLDKSAAGLEALRKLHGDAIVGVEGDV
RSLDSHREAVARCVEAFGKLDCLVGNAGVWDYLTQLVDIPDDLISEAFEEMFEVNVKGYI
LAAKAALPALYQSKGSAIFTVSNAGFYPGGGGVLYTAGKHAVIGLIKQLAHEWGPRIRVN
GIAPGGILGSDLRGLKSLDLQDKSISTFPLDDMLKSVLPTGRAATAEEYAGAYVFFATRG
DTVPLTGSVLNFDGGMGVRGLFEASLGAQLDKHFG
NT seq 828 nt   +upstreamnt  +downstreamnt
gtgagacttgaaggcgaagtggccttggtgacaggcggtggcgcaggcctgggcagagcg
atcgtggatcgttatgtcgcggaaggtgcgcgtgtcgcggtgctggataaatccgcggca
ggcctggaagcgctcaggaaactccatggcgatgcaatcgtgggcgtggagggggatgtt
cgctcgctcgacagccatcgtgaggctgtggcccgctgcgtcgaagcgttcggcaagctg
gactgcctggttggcaatgctggcgtttgggactacctgacccaactggtggatattccc
gacgacctcatatcggaggcattcgaggaaatgttcgaggtcaatgtcaagggctacatc
ctggcggcaaaggctgcgctacctgcgctttatcagagcaaaggcagcgcgatattcact
gtgtcgaatgccggtttctacccgggcggtggcggtgttctgtatacagctggcaaacat
gccgtgattggattgatcaagcagctcgcgcacgaatgggggccgcgtatccgcgtcaac
ggcatcgcccccggtggcattttggggagcgatctgcgcgggctgaagagccttgattta
caagacaagagcatttcgacctttccattggacgacatgctgaaatccgttcttccgacc
gggcgggccgccactgccgaggaatacgccggcgcctatgtcttcttcgcgacgcgcggc
gacacggttccgctcaccggtagcgtgttgaacttcgatggcggcatgggcgtgcgtggc
ttgttcgaagccagcctaggcgcacagctcgacaagcacttcggttga

DBGET integrated database retrieval system