Penaeus monodon (black tiger shrimp): 119571504 Help Entry 119571504         CDS       T08784                                  Name (RefSeq) histone H2A   KO K11251   histone H2A Organism pmoo  Penaeus monodon (black tiger shrimp) Pathway pmoo03082   ATP-dependent chromatin remodeling Brite KEGG Orthology (KO) [BR:pmoo00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     119571504  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pmoo03036]     119571504   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pmoo04147]     119571504 Chromosome and associated proteins [BR:pmoo03036]  Eukaryotic type   Nucleosome assembly factors    Histones     119571504 Exosome [BR:pmoo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    119571504 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  119571504 NCBI-ProteinID:  XP_037774711 LinkDB All DBs Position Unknown AA seq 123 aa AA seqDB search MSGRGKGGKVKGKSKSRSSRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAA EVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKT EKK NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgtctggccgtggtaagggtggtaaggtaaagggcaagtcaaagtcccgctcaagcagg gccggccttcagtttcccgtaggtaggattcaccgccttctgcgtaagggtaactatgcc gagagggtgggagctggagcccctgtgtatctcgctgccgtcatggaatacctggctgct gaagtactagaattggcaggtaatgctgcccgtgacaacaagaagacccgtatcatcccc cgtcatttgcagctggccatccgtaacgacgaagagctcaacaagctcctctctggcgtg accatcgcccagggtggtgtcctgcctaatatccaggctgtgctcctccccaagaagact gagaagaagtaa

DBGET integrated database retrieval system