KEGG   Pseudomonas monteilii SB3101: X970_10465
Entry
X970_10465        CDS       T02973                                 
Name
(GenBank) short-chain dehydrogenase
  KO
K10617  p-cumic alcohol dehydrogenase
Organism
pmot  Pseudomonas monteilii SB3101
Pathway
pmot00622  Xylene degradation
pmot01100  Metabolic pathways
pmot01120  Microbial metabolism in diverse environments
pmot01220  Degradation of aromatic compounds
Module
pmot_M00419  Cymene degradation, p-cymene => p-cumate
Brite
KEGG Orthology (KO) [BR:pmot00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00622 Xylene degradation
    X970_10465
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase
Other DBs
NCBI-ProteinID: AHC87814
UniProt: V9UX73
LinkDB
Position
2249525..2250283
AA seq 252 aa
MRLKDKVAIVTGAATGIGNAIVRSYLAEGAKVVIADVKGAEAAAAELGEDLALGVFADVS
DPDSTKQMAKAALDRFGKIDVLVNNAGIFTGLNYVPMESISVADWDKLYSVNVKGPWLCA
SAVSAAMREGGGGKIINIASVIAHIGAPFMLHYVSSKGAVAAMTRAMAREFATTKAGISV
NSISPGYTHSENALANAQQHEQFEGVSASMRAIDRPQVPADIAGVALWLASDEASYVNGQ
NIVVDGGIYMSL
NT seq 759 nt   +upstreamnt  +downstreamnt
atgagactgaaagacaaagtcgcaatcgtgactggtgcggcaaccgggattggcaacgct
atcgtgcgctcttaccttgctgagggtgcgaaggtggtcattgctgatgtgaaaggtgct
gaggcagccgcggcggaactgggtgaagacctagcgttgggtgtctttgccgacgtttcg
gatcctgatagcaccaagcagatggcaaaggcagcactggatcgcttcggcaagatcgac
gtgctcgtcaacaatgccggtatcttcaccggtctcaactatgtcccgatggaatcgatc
tcggttgcggattgggacaagctctacagtgtcaatgtcaaggggccctggctgtgcgcc
agtgcggtgtcggccgcgatgcgcgagggtggtggtggcaagatcatcaacatcgcctca
gtaatcgctcacatcggagcgcccttcatgttgcactacgtttccagcaagggcgctgtt
gcggcgatgacacgtgccatggcgcgcgaatttgcgacgaccaaggcagggatcagcgtc
aactccatctctcccggctacacccattcggaaaatgcgctcgcaaacgctcagcagcat
gagcagttcgagggcgtttctgcgtccatgcgggcaatcgatcgaccgcaagtgccggca
gatattgcgggagtggcgctttggttggctagcgacgaagcctcctacgtaaacgggcag
aacattgtggtggatggcggcatttacatgagcctctga

DBGET integrated database retrieval system