KEGG   Prunus mume (Japanese apricot): 103319663
Entry
103319663         CDS       T03196                                 
Name
(RefSeq) 7-deoxyloganetin glucosyltransferase-like
  KO
K22706  (R)-mandelonitrile beta-glucosyltransferase [EC:2.4.1.354]
Organism
pmum  Prunus mume (Japanese apricot)
Pathway
pmum00460  Cyanoamino acid metabolism
pmum01100  Metabolic pathways
pmum01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmum00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    103319663
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pmum01003]
    103319663
Enzymes [BR:pmum01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.354  (R)-mandelonitrile beta-glucosyltransferase
     103319663
Glycosyltransferases [BR:pmum01003]
 Others
  Hydrophobic molecule
   103319663
SSDB
Motif
Pfam: UDPGT
Other DBs
NCBI-GeneID: 103319663
NCBI-ProteinID: XP_008219457
LinkDB
Position
LG2:complement(5887125..5889040)
AA seq 483 aa
MSPAASKEKPHAVFVPFPAQGHINPMLQLAKLLNYKGFHITFVNTEFNHKRMLESQGSHA
LDGLPSFQFKTIPDGLPPADADARRNLPLVCDSTSKTCLAPFKALLTKLNSSPDSPPVTC
IVADGVTSFTLDAAEHFGIPEVLFWTTSACGLMGYVQYYRLIEKGLTPFKDAKDFANGYL
DTEIDWIPGMKDIRLKDMPSFIRTTDPNDIMLHYMVSETERSKKASAIILNTFDALEQEV
VDALSTLLPPIYSIGPLQLPYSEIPSEYNDLKAIGSNLWAENTECLNWLDTKEPNSVVYV
NFGSTTVMTNEQLVEFSWGLANSKKPFLWIIRPGLVAGETAVVPPEFLEETKERGMLASW
CPQEQVLLHSAIGGFLTHSGWNSTLEALCGGVPLICWPFFAEQQTNVRYSCTQWGIGIEI
DGEVKRDYIDGLVRTLMDGEEGKKMRKKALEWKKLAEEATAPKGSSYLALENVVSKVLLS
PRD
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgagtccagctgcctccaaagagaagccacatgcagtttttgtacccttcccagctcag
ggtcacataaaccctatgctgcaattagccaagctcctcaactacaaaggcttccacata
acctttgtgaacacagagttcaaccacaagcgcatgcttgaatcccaaggttcccacgct
ctcgacggcctcccttcgtttcaattcaaaaccattcccgacggcctccctccggctgat
gccgatgccaggcgcaacttgcctttggtgtgtgattccactagtaaaacctgcttggca
cccttcaaggcgcttttgaccaagctcaactcttcacccgattcccctcctgtgacttgt
attgttgctgatggtgtcaccagcttcacccttgatgcagcagagcatttcgggatccca
gaagtgcttttctggacaactagtgcttgtggcttgatgggctacgttcagtattaccgt
ctcattgagaagggcctcactccttttaaagatgccaaggattttgcaaatgggtatttg
gatacagagattgattggatcccaggcatgaaggatatcagattgaaggacatgcctagc
tttattagaaccacagacccaaacgacatcatgctgcattatatggtgtctgaaacagag
cgatccaaaaaggcttctgctattattttgaacacatttgatgccttggagcaagaagtt
gtggatgccctttccactttgctacctcctatttactccattggaccccttcagctacca
tacagcgagattccatcggaatacaatgatttgaaggcgatcggatcgaacctgtgggca
gagaatacagagtgccttaactggctggacacgaaagagcccaactctgtggtttatgtc
aactttggaagcaccacagtcatgacaaatgagcagctggttgagttttcttggggactt
gcaaatagcaagaagccatttttgtggatcatcaggcctggccttgttgctggagaaacc
gctgtggtgccgcctgagtttttggaggagaccaaagagaggggtatgttggcaagttgg
tgccctcaagaacaggttctgctccactcagccattggagggttcttgactcacagtggc
tggaactctacccttgaggccttgtgcggcggagtgcctctcatctgctggcctttcttt
gcagagcagcaaacaaatgttagatacagctgcacacagtggggcataggcattgagata
gacggggaagttaaaagagattacattgacggtcttgtgaggacattgatggatggagaa
gagggcaaaaagatgaggaagaaagcccttgaatggaagaagttggcagaggaggccact
gccccaaaagggtcgtcttacttggctctggaaaatgtggttagcaaagtgcttctttcc
ccaagagattag

DBGET integrated database retrieval system