KEGG   Polaromonas naphthalenivorans: Pnap_4152
Entry
Pnap_4152         CDS       T00459                                 
Name
(GenBank) ring hydroxylating dioxygenase, alpha subunit
  KO
K08689  biphenyl 2,3-dioxygenase subunit alpha [EC:1.14.12.18]
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna00621  Dioxin degradation
pna01100  Metabolic pathways
pna01120  Microbial metabolism in diverse environments
pna01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pna00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    Pnap_4152
Enzymes [BR:pna01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.18  biphenyl 2,3-dioxygenase
     Pnap_4152
SSDB
Motif
Pfam: Ring_hydroxyl_A Rieske zf-MIZ
Other DBs
NCBI-ProteinID: ABM39439
UniProt: A1VUW1
LinkDB
Position
pPNAP01:complement(24982..26352)
AA seq 456 aa
MSSTIKEVQESTVKWTRNWTPEAIRALVDQEKGLLDPRIYADQSLYELELERVFGRSWLL
LGHESHIPKTGDFLTTYMGEDPVVMVRQKDRSIKVFLNQCRHRGMRICRSDAGNAKAFTC
SYHGWAYDIAGNLVNVPFEQEAFCDKKEGDCGFDKADWGPLQARVATYKGLVFANWDAEA
PDLETYLGDARPYMDVMLDRTPAGTEAIGGMQKWVVPCNWKYAAEQFCSDMYHAGTMSHL
SGILAGMPPEMDLSNAQVPTKGNQFRAHWGGHGSGWFVDEPGMLMAVMGPKVTQYWTEGP
AAELAEKRLALPVRRMFGQHMNIFPTCSFLPAINTIRSWHPRGPNEIEVWAFTLVDADAP
AEIKEEYRRHNIRTFSAGGVFEQDDGENWVEIQKVLRGHKAKSQPLNAQMGLGRSQTGHP
DFPGKIGYVYAEEAARGMYHHWARMMSEPSWATLKP
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgagttcaacaataaaagaagtgcaggaatccactgtgaagtggactcgcaattggacg
cccgaggcgatccgggcgttggtcgatcaggaaaaagggctgcttgacccccgcatctat
gctgaccaaagcctttacgagctggagcttgagcgggtctttggccgctcctggctgttg
ctagggcatgagagtcacattcctaaaaccggggacttcctgaccacctacatgggcgaa
gatccggtagtcatggtgcggcagaaagaccgtagcatcaaggtgtttctgaaccagtgc
cggcaccgcggcatgcgcatctgccgctcggacgcaggtaacgccaaggcgttcacctgc
agctaccatggctgggcctacgacattgcgggtaacctggtgaacgtgccgttcgagcag
gaggcgttttgcgacaagaaggagggagactgcggctttgacaaggccgactggggtccg
ctgcaagcgcgcgtggccacctacaagggcctggtcttcgccaactgggatgccgaagcg
cccgatctggaaacctacctcggtgacgcgcgtccctacatggatgtgatgctggatcgt
actccggctggcaccgaggctataggcggcatgcaaaagtgggtggttccgtgtaactgg
aagtacgccgccgagcagttttgcagtgacatgtaccacgccgggacgatgtcacacctg
tccgggattctggcgggcatgccgccagaaatggatttgtcgaatgctcaggtgccgacc
aaggggaatcagttccgagcccattggggcgggcatggctcgggatggtttgttgacgag
ccaggcatgctcatggccgtgatgggtcccaaggtcacccagtactggaccgaaggtccc
gccgctgaacttgcagaaaaacgtctggctctgccggttcgacgcatgtttggccagcac
atgaacatcttcccaacctgttcgttcctgcccgccatcaacaccatccgaagctggcac
cctcgcggccccaatgaaatcgaggtgtgggcgttcaccctggtcgatgccgatgcaccc
gcagagatcaaggaagaatatcgccggcataacattcgcaccttctccgctgggggtgtg
ttcgagcaggacgacggcgagaattgggtcgaaatccagaaagtgctgcgcggccataag
gccaagagccagccgctcaatgcccagatgggcctgggtcggtcgcagaccggccatcct
gattttcccggaaagattggttatgtctacgccgaagaggcggcgcggggcatgtaccac
cactgggcccgcatgatgtcggagccaagctgggccacgctaaaaccctga

DBGET integrated database retrieval system