KEGG   Parastagonospora nodorum: SNOG_05032
Entry
SNOG_05032        CDS       T01161                                 
Name
(RefSeq) hypothetical protein
  KO
K21820  unspecific peroxygenase [EC:1.11.2.1]
Organism
pno  Parastagonospora nodorum
Brite
KEGG Orthology (KO) [BR:pno00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SNOG_05032
Enzymes [BR:pno01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.2  Peroxygenases
    1.11.2.1  unspecific peroxygenase
     SNOG_05032
SSDB
Motif
Pfam: Peroxidase_2
Other DBs
NCBI-GeneID: 5972318
NCBI-ProteinID: XP_001795443
UniProt: Q0UT82
LinkDB
Position
Unknown
AA seq 411 aa
MHTLSSLLVLSSATSAWGYGWVASQAGVDSSLLREARYANNKRQTTCPFNADHKGAAPYT
SQYPYTGAKNGVPGSQKGGIKVPADGDTAHYYTAPGPNDIRGPCPGLNAAANHNFLSHDG
VTNFNELVDAQQNVYNVGYDLSVLLAVLGIQADGDIVTTKLSIGCDATSRTALLPLLGRQ
PGLNGHNKFEGDSSLTRTDYFLNNGDNYSFNGSLFAEMKSFADTVSGGKFDLDALAAYRG
KRYDESLATNAASFLYELFPSYGDKGVADLATMKSFFGAVEDANAPGGWAHVPERIPENW
FSRVAPYTNNDVVQQILAMYLKAPKLFGGNIGVNNFDGLGTFGKIQGGELPNDATAGDVL
CLLYQLATMAVPSSLSTVTDITAAALNFSVGKLNPVFKNQGCALKPDQTQG
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgcatactctctcatctcttctcgttctctcttctgccaccagtgcttggggctatggt
tgggttgccagtcaagctggcgtagattcctccctgctgagagaagctcggtacgccaac
aacaagcgtcagacaacttgccccttcaacgcagaccataagggtgccgcgccctacaca
tctcaatacccatacacaggagcgaagaatggtgttcctggatcgcaaaagggcggcatc
aaggtgccagccgatggcgacactgcccattactacactgctccaggaccgaacgacatc
cgaggaccttgcccaggcttgaacgccgcagcaaaccacaatttcttgtctcacgacgga
gtcaccaacttcaatgagcttgtcgatgctcaacagaacgtctacaacgttggctacgac
ctttcagtcctcctggctgtgctcggtatccaagccgacggtgacattgtcacgaccaag
ctcagtatcggatgcgatgctacttctcgcactgcgctgctgccactgctcggtcgccag
cccggacttaatggacacaacaaattcgagggtgattcttcgcttacccgtaccgactac
ttcctcaacaatggcgacaactactctttcaacggctcactctttgctgagatgaagtca
ttcgccgatactgtctcgggcggtaaatttgaccttgatgcgcttgctgcataccgtggc
aagcgttatgacgaatctctcgccaccaacgccgcatccttcctctacgaacttttccca
tcttacggcgacaagggcgtagccgacctcgccacaatgaaaagcttcttcggcgccgta
gaagacgccaacgcacccggcggctgggcccacgtcccagagcgcattcccgagaactgg
ttcagccgtgtcgctccctataccaacaacgacgtcgtgcaacagatcttggccatgtac
ctgaaggctcccaagctcttcggcggcaacatcggcgtcaacaactttgacggcctcggt
acctttggtaagatccagggcggtgaactgcccaacgatgccactgcgggagacgtgctg
tgtctgctgtaccagctggctaccatggctgtgccgtcgagcttgagcactgtcacggac
attacggctgcggcgctgaacttcagtgttgggaagctcaaccctgtgtttaagaaccag
ggatgcgcgttgaagccggaccagactcagggctag

DBGET integrated database retrieval system