KEGG   Paenarthrobacter nicotinovorans: JMY29_20620
Entry
JMY29_20620       CDS       T08055                                 
Name
(GenBank) carbon-nitrogen family hydrolase
  KO
K08590  2-oxoglutaramate amidase [EC:3.5.1.111]
Organism
pnv  Paenarthrobacter nicotinovorans
Pathway
pnv00250  Alanine, aspartate and glutamate metabolism
pnv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pnv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    JMY29_20620
Enzymes [BR:pnv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.111  2-oxoglutaramate amidase
     JMY29_20620
SSDB
Motif
Pfam: CN_hydrolase
Other DBs
NCBI-ProteinID: UKF06204
LinkDB
Position
pAO1:complement(106700..107575)
AA seq 291 aa
MEVRELAPSRGQLDVAAVQVKFDSTELLEDRISRIQDLVSGVGKADLIVLPELWLHGGFS
YDSWRKNAISLESEVFTFLSEVARDKKAWFHAGSFMVTEPSSAASDMWNTSVLFDPTGSL
RATYKKIHRFGFSDGEPKLIAAGDEPRVVELQTERATAITGLSTCYDLRFPELYRHISAE
GTALNVIPACWPLTRIQHWQTLGRARAIENQSFVVQCNMTGVDQEVELGGHSQIVDGNGD
ILAQADKEEAVLRATLNFDSLNELRSSFPVLNDRRADIWAAKGKTVIASHL
NT seq 876 nt   +upstreamnt  +downstreamnt
atggaagtgcgcgaactagcaccaagtagagggcaacttgacgtagcagctgttcaggtg
aaatttgactcaacagagctgctcgaggacaggatttcgcgtatccaggacttggtttct
ggcgtcggcaaagcggacctgatcgtcctgcctgaactctggcttcatggcgggttctcc
tacgacagctggcgaaagaacgccatttcgctggaaagtgaagtgttcactttcctgtcc
gaagtggccagggacaagaaggcctggtttcacgccggctctttcatggtcacggaacca
agcagcgctgcttctgacatgtggaatacatcggttctttttgacccgaccggatccctc
cgggcgacctataaaaagatccaccgcttcggcttttccgacggagagccaaagctgata
gcagcgggagatgaacccagggtggtggagctgcagacagaacgagccactgccatcact
gggctcagcacatgctacgatcttcgcttccccgaactatatcgacacatctcagcagaa
ggtacggcgctcaatgtgataccagcatgctggccacttacgcgaattcagcattggcag
actctgggtcgcgctcgagcaatcgaaaaccaatcctttgtcgtgcaatgcaacatgacg
ggggttgaccaggaggtggagctgggtggtcacagtcagattgtggatggcaacggagat
atcctcgctcaggcagacaaagaggaagccgttctccgtgcaactctcaatttcgattca
ctgaacgaactgcgaagttcgttcccggtgctgaacgaccggcgggcagatatctgggct
gctaagggcaagaccgtgatcgcaagccacttgtag

DBGET integrated database retrieval system