KEGG   Pontibacillus sp. HMF3514: GS400_05100
Entry
GS400_05100       CDS       T06374                                 
Name
(GenBank) BMP family ABC transporter substrate-binding protein
  KO
K05519  transcriptional activator of comK gene
Organism
pof  Pontibacillus sp. HMF3514
Brite
KEGG Orthology (KO) [BR:pof00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pof03000]
    GS400_05100
Transcription factors [BR:pof03000]
 Prokaryotic type
  Other transcription factors
   Others
    GS400_05100
SSDB
Motif
Pfam: Bmp
Other DBs
NCBI-ProteinID: QHE51447
UniProt: A0A6P1HFV0
LinkDB
Position
972047..973003
AA seq 318 aa
MLPRLLLISVLVMGVLSGCADTMGKGKIQKVGMLVENTVHDQAWGQKGYKGLLQIKEELD
VDVYFKEHIQTKKATHKAVQEFSQKGVNLVFGHGSHFGQYFDEIQKAYPDIHFVYFNGNI
KGENITSLNFSAHAMGFFGGMVAGGFSKTNHVGIIAAYEWQPEVEGFYEGVKYQNPNVDV
TIRYVRSWDNKMRAKQIYNQMKSQNVDVYYPAGDSFSVPLIRQMNEDGFHAIGYVSDQSD
IAPNTILTSTIQHVDRLYVQTAKQFNKGELKSGILTFDFQDNAITLGKFSPNIPEPLVDK
VKSAVQQYKKTGQLPHEM
NT seq 957 nt   +upstreamnt  +downstreamnt
atgttgccgcgtttgcttctcatatccgtcctagtgatgggtgtattatcgggttgtgct
gatacgatgggaaaaggcaaaattcaaaaggtaggcatgcttgtggagaatacagtccat
gatcaagcttggggtcaaaaaggatataagggccttcttcaaataaaagaagagctcgat
gttgatgtgtattttaaagaacatattcaaacgaaaaaggctacacataaagccgtccaa
gaattctcgcaaaaaggtgtaaatcttgtattcggtcatggcagtcattttggacagtat
tttgatgaaatacaaaaagcctatcctgatattcattttgtatattttaatgggaatata
aaaggcgaaaacattacaagcttaaattttagcgcacatgctatgggcttctttggtggt
atggttgcaggtggtttttcaaagacaaaccacgtggggataattgctgcttatgagtgg
caacctgaagttgaaggattttatgaaggagtcaagtatcaaaacccaaatgtagatgta
actattcgatacgtaagaagttgggacaacaaaatgcgggcgaaacagatttacaatcag
atgaagtctcaaaatgtggatgtttattatccagcaggtgatagctttagcgtaccttta
attaggcaaatgaatgaagatggatttcatgctattgggtatgtaagtgaccaatcagac
attgctccaaataccatcttaacaagtacgattcagcatgtagatcgtttatatgttcaa
acggcgaaacagtttaacaaaggggaattgaaatcaggcattttaacgtttgattttcaa
gacaatgcgattacgttagggaaatttagcccaaatatacctgaaccattagttgataaa
gttaaatcagctgtccaacaatacaaaaaaactggacaactcccacatgagatgtga

DBGET integrated database retrieval system