KEGG   Pongo abelii (Sumatran orangutan): 100436117
Entry
100436117         CDS       T01416                                 
Symbol
MRAP
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04927  Cortisol synthesis and secretion
pon04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:pon00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    100436117 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100436117 (MRAP)
SSDB
Motif
Pfam: MRAP FixQ
Other DBs
NCBI-GeneID: 100436117
NCBI-ProteinID: XP_009232152
UniProt: A0A2J8UKV3
LinkDB
Position
21:19966951..19990745
AA seq 172 aa
MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHSIVIAFWVSLAAFVVLLFLILLYM
SWSGSLHMRNSPKHHPTCPWSHSLNLHLCIQKCLLRYREPLATSQAQASSVEPGSRTGLD
QPLRQESSSTLPLGVFQTHPTLLWQLTLSGGPLVRSKPSEPPPGDRTSQLQS
NT seq 519 nt   +upstreamnt  +downstreamnt
atggccaacgggaccaacgcctctgccccatactacagctatgaatactacctggactat
ctggacctcattcccgtggacgagaagaagctgaaagcccacaaacattccatcgtgatc
gcattctgggtgagcctggctgccttcgtggtgctcctcttcctcatcctgctgtacatg
tcctggtccggctccctgcacatgaggaacagccccaagcaccacccaacatgcccctgg
agccacagcctcaacctccacctctgcatccagaagtgcctgctgcgctacagggaaccc
ctggcaacctcacaggctcaggcgagctcagtggagccagggagcagaactggccttgac
cagccgctacgacaggagagctcctccaccttgcccctcggggttttccagacccaccct
actctcctctggcaactgaccctcagtgggggtcccctcgtcaggagcaagcccagtgag
cctccccctggagacaggacctctcaattgcagagctga

DBGET integrated database retrieval system