KEGG   Pongo abelii (Sumatran orangutan): 100440032
Entry
100440032         CDS       T01416                                 
Symbol
ITGAX
Name
(RefSeq) LOW QUALITY PROTEIN: integrin alpha-X
  KO
K06462  integrin alpha X
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04610  Complement and coagulation cascades
pon04810  Regulation of actin cytoskeleton
pon05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100440032 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100440032 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100440032 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:pon04515]
    100440032 (ITGAX)
   04090 CD molecules [BR:pon04090]
    100440032 (ITGAX)
Cell adhesion molecules [BR:pon04515]
 Integrins
  Integrin alpha subunits
   100440032 (ITGAX)
CD molecules [BR:pon04090]
 Proteins
  100440032 (ITGAX)
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 Integrin_alpha VWA_CoxE FG-GAP_2
Other DBs
NCBI-GeneID: 100440032
NCBI-ProteinID: XP_024089330
LinkDB
Position
16:21138502..21169883
AA seq 1163 aa
MTRTRAALLLFTALATSLGFNLDTEELTAFHVDSAGFGDSVVQYANSWVVVGAPEKITAA
NQTGGLYQCGYSTGACKPISLQVPLEAVNMSLGLSLAATTSPSRLLACGPTVHHACGRNM
YLTGLCFLLAPAQLTQRLPASRQECPRQEQDIVFLIDGSGSISSDNFATMMNFVRAVISQ
FQRPSTQFSLMQFSNKFQTHFTFEKFRSSSNPLSLLDSVHQLRGLTHTATAIQNVVHRLF
HASYGARRDAAKILIVITDGKKEGDRLDYKDVIPMADAAGIIRYAIGVGSAFEYINSWKE
LNDIASKPSQEHIFKVEDFEALKDIQNQLKEKIFAIEGTETTSSSSFELEMAQEGFSAVF
TPDGPVLGAVGSFTWSGGAFLYPPNMNPTFINMSQENMDMRDSYLGYSTELALWKGVQSL
VLGAPRYQHTGKAVIFTQVSRQWRMKAEVTGTQIGSYFGASLCSVDVDSDGSTDLVLIGA
PHYYEQTRGGQVSVCPLPRGWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVV
IGAPGEEENRGAVYLFHGVLGPSISPSHSQRIAGSQLSSRLQYFGQALSGGQDLTQDGLV
DLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLGQSSICLYIDK
RSKNLLGSRDLKSSVTLDLALDPGRLSPRANFQETKNRSLSRVRVLGLEAHCENFNLLLP
TCVEDSVTPITLRLNFTLVGKPLPAFRNLRPMLAADAQRYFTASLPFEKNCGADHICQDN
LGISFSFPGLKTLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPAGLSYRSVAEGQKQGQ
MRSLRLTCDSAPAGSQGTWSTSCRINHLIFHGGTQITFLATFDVSPKAVLGDRLLLTANV
SSENNTPRTNKTTFQLELPVKYAVYTVASSHEQFTKYLNFSDSEEKESHVAVHRYQVNNL
GQRDLPVSINFWVPVELNQEAVWMDVEVFHPQNPSLQCSSEKIAPPASDFLSHIQKNPVL
DCSIACCLRFRCDVPFFSVQEELDFTLKGNLSFGWVRQTSQKKVSVMSVAEITFNTSVYS
QLPGQEAFMRAQTTTVLEKYKVHNPTPLIVGSSIGGLLLLALITAVLYKVGFFKRQYKEM
MEEANGQIAPENGTXTPNPPSEK
NT seq 3492 nt   +upstreamnt  +downstreamnt
atgaccaggaccagggcagcactcctcctgttcacagccttagcgacttctctaggtttc
aacttggacacagaggagctgacagccttccatgtggacagcgctgggtttggagacagc
gtggtccagtatgccaactcctgggtggtggttggagcccccgaaaagataacagctgcc
aaccaaacgggtggcctctaccagtgcggctacagcactggtgcctgtaagcccatcagc
ctgcaggtccccctggaggccgtgaacatgtccctgggcctgtccctggcggctaccacc
agcccttcccggctgctggcctgcggccccaccgtgcaccacgcgtgcgggagaaacatg
tacctgaccggactctgcttcctcctggccccggcccagctcacccagaggctcccggca
tccaggcaggagtgcccaagacaggagcaggacattgtgttcctgatcgatggctcaggc
agcatctcctccgacaactttgccacgatgatgaacttcgtgagagctgtgataagccag
ttccagaggcccagcacccagttttccctgatgcagttctccaacaaattccaaacacac
ttcacttttgagaaattcaggagcagctcaaaccccctcagcctgttggattctgttcac
cagctgagagggttaacacacacggccaccgccatccaaaatgtcgtgcacagattgttc
catgcctcatatggggcccgtagggatgctgccaaaattctcattgtcatcactgatggg
aagaaagaaggcgacaggctggattataaggatgtcatccccatggctgacgcagcaggc
atcatccgctatgcaattggggttggatcagcttttgaatacataaattcttggaaagaa
ttaaatgacattgcatcgaagccctcccaggaacacatatttaaagtggaggactttgag
gctctgaaagatattcaaaaccaactgaaggagaagatctttgccattgagggtacggag
accacaagcagtagctccttcgaattggagatggcacaggagggcttcagcgctgtgttc
acgcctgatggccccgttctgggggctgtggggagcttcacctggtctggaggtgccttc
ctgtaccccccaaatatgaaccccaccttcatcaacatgtctcaggagaatatggacatg
agggactcttacctgggttactccaccgagctggccctctggaaaggggtgcagagcctg
gtcctgggggccccccgctaccagcacaccgggaaggctgtcatcttcacccaggtgtcc
aggcaatggaggatgaaggccgaagtcacggggacccagatcggctcttacttcggggcc
tccctctgctctgtggacgtggacagcgacggcagcactgacctggtcctcatcggggcc
ccccattactacgagcagacccgagggggccaggtgtctgtgtgtcccttgcccaggggg
tggagaaggtggtggtgtgatgctgttctctacggggagcagggccacccctggggtcgc
tttggggcggccctgacagtgctgggggatgtgaatggggacaagctgacggacgtggtc
atcggggccccaggagaggaggagaaccggggtgctgtctacctgtttcacggagtcttg
ggacccagcatcagcccctcccacagccagaggatcgccggctcccagctctcctccagg
ctgcagtattttgggcaggcgctgagcgggggtcaagacctcacccaggatggactggtg
gacctggccgtgggggcccgaggccaggtgctcctgctcaggaccagacctgtgctctgg
gtgggggtgagcatgcagttcatacctgcggagatccctaggtctgcgtttgagtgtcgg
gagcaggtggtctctgagcagaccctgggacagtccagcatctgcctttacattgacaaa
cgttccaagaacctgcttgggagccgtgacctcaaaagctctgtgaccttggacctggcc
ctcgaccctggccgcctgagtccccgtgccaacttccaggaaacaaagaaccggagtctg
agccgagtccgagtcctcgggctggaggcacactgtgaaaacttcaacctgctgctcccg
acctgcgtggaggactctgtgacccccatcaccttgcgtctgaacttcacgctggtgggc
aagcccctccctgccttcagaaacctgcggcctatgctggccgccgatgctcagagatac
ttcacggcctccctaccctttgagaagaactgtggagccgaccatatctgccaggacaat
ctcggcatctccttcagcttcccaggcttgaagaccctgctggtggggagtaacctggag
ctaaatgcagaagtgatggtgtggaatgacggggaagactcctacggaaccaccatcacc
ttctcccacccggcaggactgtcctaccgctccgtggcagagggccagaaacaagggcag
atgcgttccctgcgcctgacatgtgacagcgccccagctgggagccagggcacctggagc
accagctgcagaatcaaccacctcatcttccatggcggcacccagatcaccttcttggct
acctttgacgtctcccccaaggctgtcctgggagaccggctgcttctgacagccaatgtg
agcagtgagaacaacactcccaggaccaacaagaccaccttccagctggagctcccggtg
aagtacgccgtctacactgtggctagcagccacgaacaattcaccaagtacctcaacttc
tcagactctgaggagaaggaaagccatgtggccgtgcacagataccaggtcaataacctg
ggacagagggacttgcctgtcagcatcaacttctgggtgcctgtggagctgaaccaggag
gctgtgtggatggatgtggaggtcttccacccccagaacccatcccttcagtgttcctca
gagaaaatcgcacccccagcatctgacttcctgtcgcacattcagaagaatcccgtgctg
gactgctccattgcttgctgcctgcggttccgctgtgacgtccccttcttcagtgtccag
gaggagctggatttcaccctgaagggcaacctcagcttcggctgggtccgccagacatcg
cagaagaaggtgtcagtcatgagtgtggctgaaattacgttcaacacatccgtgtactcc
cagcttccaggacaggaggcatttatgagagctcagacgacaacggtgctggagaagtac
aaggtccacaaccccaccccgctcatcgtaggcagctccattggaggtctgctgctgctg
gcactcatcacagcggtactgtacaaagttggcttcttcaagcgtcagtacaaggaaatg
atggaggaggcaaatggacaaattgccccagaaaacgggacatagacccccaacccgccc
agtgagaaatga

DBGET integrated database retrieval system