Pongo abelii (Sumatran orangutan): 100935729 Help Entry 100935729         CDS       T01416                                  Symbol GHRH Name (RefSeq) somatoliberin isoform X1   KO K05260   growth hormone-releasing hormone Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04080   Neuroactive ligand-receptor interaction pon04081   Hormone signaling pon04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     100935729 (GHRH)    04081 Hormone signaling     100935729 (GHRH)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     100935729 (GHRH)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pon04052]     100935729 (GHRH) Cytokines and neuropeptides [BR:pon04052]  Neuropeptides   GPCR binding    100935729 (GHRH) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_2 Motif Other DBs NCBI-GeneID:  100935729 NCBI-ProteinID:  XP_054398230 Ensembl:  ENSPPYG00000036425 UniProt:  A0A2J8VJN4 LinkDB All DBs Position 21:complement(41414537..41453007) Genome browser AA seq 108 aa AA seqDB search MPLWVFFFVILTLSSSSHCSPPPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSR QQGESNQERGARARLGRQVDGMWAEQKQMELESILVALLQKHSRNSQG NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgccactctgggtgttcttctttgtgatcctcaccctcagcagcagctcccactgctcc ccacctccccctttgaccctcaggatgcggcggtatgcagatgccatcttcaccaacagc taccggaaggtgctgggtcagctgtccgcccgcaagctgctccaggacatcatgagcagg cagcagggagagagcaaccaagagcgaggagcaagggcacggcttggccgccaggtagat ggcatgtgggcagaacaaaagcaaatggaattggagagcatcctggtggccctgctgcag aagcacagcaggaactcccagggatga

DBGET integrated database retrieval system