KEGG   Pongo abelii (Sumatran orangutan): 100936476
Entry
100936476         CDS       T01416                                 
Symbol
TP53AIP1
Name
(RefSeq) p53-regulated apoptosis-inducing protein 1 isoform X2
  KO
K13773  p53-regulated apoptosis-inducing protein 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04115  p53 signaling pathway
pon04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100936476 (TP53AIP1)
   04115 p53 signaling pathway
    100936476 (TP53AIP1)
SSDB
Motif
Pfam: TPIP1
Other DBs
NCBI-GeneID: 100936476
NCBI-ProteinID: XP_009245525
UniProt: A0A2J8WZI2
LinkDB
Position
11:complement(121842663..121856535)
AA seq 108 aa
MGSSSKVSFRSAQASCSGTRRQGLGRGDQNLSVMLPNGRAQTHTLGWVSPCSENRDGLLP
ATAPGRLCSHRGADIPSFQTHQDPVTTSGSSELHGDCPQFRALDGAGN
NT seq 327 nt   +upstreamnt  +downstreamnt
atggggtcttcctctaaggtgagcttcagatctgctcaagcttcctgcagtgggaccagg
aggcagggcctgggcaggggagaccagaacctctcggtgatgcttccgaatggcagggct
cagacacacacactgggctgggtaagtccctgcagtgaaaaccgagatggtcttttgcct
gccacggccccgggcagactctgctctcaccgtggtgccgacatcccaagttttcagact
caccaggacccagtgacaacatctgggtcctcggagctgcatggagactgtccccagttc
agggcattagacggagctgggaactga

DBGET integrated database retrieval system