Populus trichocarpa (black cottonwood): 7480750 Help Entry 7480750           CDS       T01077                                  Name (RefSeq) sm-like protein LSM2   KO K12621   U6 snRNA-associated Sm-like protein LSm2 Organism pop  Populus trichocarpa (black cottonwood) Pathway pop03018   RNA degradation pop03040   Spliceosome Brite KEGG Orthology (KO) [BR:pop00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     7480750   09123 Folding, sorting and degradation    03018 RNA degradation     7480750  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pop03019]     7480750    03041 Spliceosome [BR:pop03041]     7480750 Messenger RNA biogenesis [BR:pop03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      7480750   mRNA degradation factors    5'-3' decay     Lsm complex      7480750 Spliceosome [BR:pop03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     7480750  Complex C   U2 snRNP components     7480750 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM SM-ATX LSM14 DUF150_C DUF1256 Motif Other DBs NCBI-GeneID:  7480750 NCBI-ProteinID:  XP_002304049 UniProt:  A9PD52 LinkDB All DBs Position 3:complement(1656456..1658738) Genome browser AA seq 93 aa AA seqDB search MLFFSYFKDLVGKEVTVELKNDLAIRGTLHSVDQYLNIKLENTRVVDQDKYPHMLSVRNC FIRGSVVRYVQLPPEGVDVDLLHDATRREARGG NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgttgtttttttcgtatttcaaggatttggtagggaaagaagtgacggtggagctgaag aatgatttggctataagagggactcttcactctgtggatcagtacctcaacatcaagctc gaaaacactcgcgttgtcgatcaagacaagtatcctcacatgctttctgtcaggaactgt ttcataaggggatcagtagtgagatatgttcaacttcctccagagggtgtggatgttgat ctgcttcacgatgccacgagaagggaagctcggggtggctga

DBGET integrated database retrieval system