Polaromonas sp. SP1: DT070_18030 Help Entry DT070_18030       CDS       T05689                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism pos  Polaromonas sp. SP1 Pathway pos02024   Quorum sensing pos03018   RNA degradation Brite KEGG Orthology (KO) [BR:pos00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     DT070_18030  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     DT070_18030  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pos03019]     DT070_18030    03036 Chromosome and associated proteins [BR:pos03036]     DT070_18030 Messenger RNA biogenesis [BR:pos03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      DT070_18030 Chromosome and associated proteins [BR:pos03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     DT070_18030 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  AYQ29744 LinkDB All DBs Position complement(3793994..3794263) Genome browser AA seq 89 aa AA seqDB search MNTENIVSNNKGQLLQDPFLNTLRREHVPVSIYLVNGIKLQGQIESFDQYVVLLRNTVTQ MVYKHAISTIVPGRAVNFATSESEESPAS NT seq 270 nt NT seq  +upstreamnt  +downstreamnt ttgaacacggaaaatatcgtgagcaacaacaaaggccagctcttgcaggacccatttctc aacaccttgcgtcgcgagcatgttcctgtttccatttatctcgtcaacgggatcaaattg cagggccagatcgaatccttcgatcaatacgtggttctgcttcgcaacactgtgacccag atggtctacaagcatgcgatctccaccatcgttccgggtcgcgccgtgaatttcgcgacc agtgagtctgaagaaagccccgccagctga

DBGET integrated database retrieval system