KEGG   Komagataella phaffii: PAS_FragB_0028
Entry
PAS_FragB_0028    CDS       T01092                                 
Name
(RefSeq) hypothetical protein
  KO
K06663  DNA damage checkpoint protein
Organism
ppa  Komagataella phaffii
Pathway
ppa04111  Cell cycle - yeast
ppa04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:ppa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    PAS_FragB_0028
   04113 Meiosis - yeast
    PAS_FragB_0028
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppa03400]
    PAS_FragB_0028
DNA repair and recombination proteins [BR:ppa03400]
 Eukaryotic type
  Check point factors
   Rad17-Mec3-Ddc1 complex
    PAS_FragB_0028
SSDB
Motif
Pfam: Rad9
Other DBs
NCBI-GeneID: 8197470
NCBI-ProteinID: XP_002490838
UniProt: C4QZ84
LinkDB
Position
1:2712901..2714400
AA seq 499 aa
MFSFLGVISSQENQQLWVRTIYSLSQISEHVQMKIRKYANGSDEIILESLNLSRTTLLRC
QFGKSFFSKFSINGELPISKNAKQKFSEVAILLNSRSFSLLFKSFRVDDVDLLKFSLAEV
EDTEQRLRTVNNKLFVEVVQKTQTKKLYALNYVGNEKIQETNIIQAYKEQLKRQESRGRK
RAEDVVQTDDSICHINMDVSILKEFFDMLPNNVVDFKIDIYPDLRKCSFQGFDKQQLLSN
KVNSLLKQPISLSVAFFLNEFNEDNIDQQLENKLSIIFPLKEFRAFVSLLNEFNDRNKFF
KTTSSENGTTQGVNVNNDVDLLFRDQGWPILFEKDWKNVCRLVLVQLTESDEIVNLTNKE
IETKELNVADFKGRRLLSMEREQERNTPMPETNTASKENAPPPQPQENGGEYAEPLFVPQ
DEEYTENDTFSYGEVTEVRWNRLKEISINSDDIQVQESMNCGDDNTGRKRPRLYRNTDES
DEEMELGPTQIDRVQGLFD
NT seq 1500 nt   +upstreamnt  +downstreamnt
atgttctccttcttgggagttatttcttcacaagaaaaccaacagttatgggttcgaacc
atatacagtttgagccagatctctgaacatgtgcaaatgaaaattcgcaagtatgcgaac
ggctcggatgaaatcattttagaatcactcaatctctctagaaccacgttattgagatgt
cagtttggcaagtcttttttctccaagttcagcatcaatggtgagctcccaatatcaaag
aacgctaagcagaagtttagcgaggttgcaatactgttaaatagccgaagtttcagcttg
cttttcaaaagtttcagagttgatgatgttgatctattaaagttctcgctagcagaggta
gaagatacggaacaaaggttgaggaccgtgaataataagctgtttgttgaagttgttcag
aaaacccagaccaaaaagctctatgccttgaactatgtcggtaatgaaaaaatccaggaa
accaatataattcaggcttataaggagcagttgaaacgacaagaaagcaggggccgaaaa
cgagctgaagatgttgttcagacggatgatagtatttgtcacataaacatggatgtttcc
atacttaaggaatttttcgatatgttgccgaacaacgttgtggatttcaagatagatatt
tatcccgaccttaggaaatgctcatttcaagggtttgacaaacagcagttactgagtaat
aaagttaacagtctactcaaacagcctatctcactgagtgttgccttcttcttgaacgag
tttaatgaggataacattgatcaacaactggagaataaattgtcaataatttttcctctg
aaagagttcagagcgtttgtttccctgttgaatgaattcaatgatagaaataagtttttc
aaaaccaccagctcggaaaatggtaccacacagggagtgaatgtaaacaacgacgttgat
cttttgttcagagatcaaggctggcccattttatttgagaaagattggaagaacgtttgc
cggctggttttggttcaattaacagaatcggatgagattgtgaacttgacgaataaagaa
attgaaactaaagagttgaacgttgcggatttcaagggaagaagactgctaagcatggaa
agggaacaggagagaaacacacccatgcccgaaaccaacacagcttcgaaggagaacgca
ccaccgccacagccgcaagagaatggaggtgaatacgctgagcctttgtttgttccccaa
gacgaagaatatactgaaaatgatacttttagctacggagaagtcactgaagtgagatgg
aaccgtttgaaggaaataagtatcaattcagacgacattcaagttcaagaaagtatgaac
tgtggtgatgataacacgggacgtaaacgtccaagactatacagaaacacagatgaatca
gacgaagagatggagttaggtcccactcagatcgatagagtgcaaggtctttttgattag

DBGET integrated database retrieval system