KEGG   Panthera pardus (leopard): 109249696
Entry
109249696         CDS       T06062                                 
Symbol
MRAP
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad04927  Cortisol synthesis and secretion
ppad04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    109249696 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109249696 (MRAP)
SSDB
Motif
Pfam: MRAP FixQ
Other DBs
NCBI-GeneID: 109249696
NCBI-ProteinID: XP_019275737
UniProt: A0A6P4TQP2
LinkDB
Position
Unknown
AA seq 111 aa
MAKQTNASTLSDSYEYYLDYVDLIPVDERELRANKYLIVIAFWVSLAFFVMLLFLILLYM
SWSGSSQVRNNAQHHPTRPWSRGLNLPLCVRRHPTGSPGLGQGARQQSIPP
NT seq 336 nt   +upstreamnt  +downstreamnt
atggccaagcagaccaacgcctccaccctgtccgacagctacgaatactacttggactac
gtggacctcattcccgtggacgagagggagctgagagccaacaaatatctgattgtcatt
gccttctgggtgagcctggcatttttcgtcatgcttctcttcctcatcctgctctacatg
tcctggtcagggtcctcgcaggtgaggaataacgcccagcaccacccaacacgcccctgg
agtcgcggcctcaacctcccgctctgcgtccggaggcaccccacaggctcccccgggctc
gggcaaggagccaggcagcagagcatcccgccctga

DBGET integrated database retrieval system