Panthera pardus (leopard): 109266785 Help Entry 109266785         CDS       T06062                                  Symbol JUN Name (RefSeq) transcription factor AP-1   KO K04448   transcription factor AP-1 Organism ppad  Panthera pardus (leopard) Pathway ppad01522   Endocrine resistance ppad04010   MAPK signaling pathway ppad04012   ErbB signaling pathway ppad04024   cAMP signaling pathway ppad04137   Mitophagy - animal ppad04210   Apoptosis ppad04310   Wnt signaling pathway ppad04380   Osteoclast differentiation ppad04510   Focal adhesion ppad04530   Tight junction ppad04620   Toll-like receptor signaling pathway ppad04621   NOD-like receptor signaling pathway ppad04625   C-type lectin receptor signaling pathway ppad04657   IL-17 signaling pathway ppad04658   Th1 and Th2 cell differentiation ppad04659   Th17 cell differentiation ppad04660   T cell receptor signaling pathway ppad04662   B cell receptor signaling pathway ppad04668   TNF signaling pathway ppad04722   Neurotrophin signaling pathway ppad04912   GnRH signaling pathway ppad04915   Estrogen signaling pathway ppad04921   Oxytocin signaling pathway ppad04926   Relaxin signaling pathway ppad04932   Non-alcoholic fatty liver disease ppad04933   AGE-RAGE signaling pathway in diabetic complications ppad05030   Cocaine addiction ppad05031   Amphetamine addiction ppad05132   Salmonella infection ppad05133   Pertussis ppad05135   Yersinia infection ppad05140   Leishmaniasis ppad05142   Chagas disease ppad05161   Hepatitis B ppad05162   Measles ppad05166   Human T-cell leukemia virus 1 infection ppad05167   Kaposi sarcoma-associated herpesvirus infection ppad05169   Epstein-Barr virus infection ppad05170   Human immunodeficiency virus 1 infection ppad05171   Coronavirus disease - COVID-19 ppad05200   Pathways in cancer ppad05203   Viral carcinogenesis ppad05207   Chemical carcinogenesis - receptor activation ppad05208   Chemical carcinogenesis - reactive oxygen species ppad05210   Colorectal cancer ppad05211   Renal cell carcinoma ppad05224   Breast cancer ppad05231   Choline metabolism in cancer ppad05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ppad05321   Inflammatory bowel disease ppad05323   Rheumatoid arthritis ppad05417   Lipid and atherosclerosis ppad05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ppad00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109266785 (JUN)    04012 ErbB signaling pathway     109266785 (JUN)    04310 Wnt signaling pathway     109266785 (JUN)    04668 TNF signaling pathway     109266785 (JUN)    04024 cAMP signaling pathway     109266785 (JUN)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     109266785 (JUN)   09143 Cell growth and death    04210 Apoptosis     109266785 (JUN)   09144 Cellular community - eukaryotes    04510 Focal adhesion     109266785 (JUN)    04530 Tight junction     109266785 (JUN)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109266785 (JUN)    04621 NOD-like receptor signaling pathway     109266785 (JUN)    04625 C-type lectin receptor signaling pathway     109266785 (JUN)    04660 T cell receptor signaling pathway     109266785 (JUN)    04658 Th1 and Th2 cell differentiation     109266785 (JUN)    04659 Th17 cell differentiation     109266785 (JUN)    04657 IL-17 signaling pathway     109266785 (JUN)    04662 B cell receptor signaling pathway     109266785 (JUN)   09152 Endocrine system    04912 GnRH signaling pathway     109266785 (JUN)    04915 Estrogen signaling pathway     109266785 (JUN)    04921 Oxytocin signaling pathway     109266785 (JUN)    04926 Relaxin signaling pathway     109266785 (JUN)   09156 Nervous system    04722 Neurotrophin signaling pathway     109266785 (JUN)   09158 Development and regeneration    04380 Osteoclast differentiation     109266785 (JUN)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109266785 (JUN)    05207 Chemical carcinogenesis - receptor activation     109266785 (JUN)    05208 Chemical carcinogenesis - reactive oxygen species     109266785 (JUN)    05203 Viral carcinogenesis     109266785 (JUN)    05231 Choline metabolism in cancer     109266785 (JUN)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     109266785 (JUN)   09162 Cancer: specific types    05210 Colorectal cancer     109266785 (JUN)    05211 Renal cell carcinoma     109266785 (JUN)    05224 Breast cancer     109266785 (JUN)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     109266785 (JUN)    05170 Human immunodeficiency virus 1 infection     109266785 (JUN)    05161 Hepatitis B     109266785 (JUN)    05171 Coronavirus disease - COVID-19     109266785 (JUN)    05162 Measles     109266785 (JUN)    05167 Kaposi sarcoma-associated herpesvirus infection     109266785 (JUN)    05169 Epstein-Barr virus infection     109266785 (JUN)   09171 Infectious disease: bacterial    05132 Salmonella infection     109266785 (JUN)    05135 Yersinia infection     109266785 (JUN)    05133 Pertussis     109266785 (JUN)   09174 Infectious disease: parasitic    05140 Leishmaniasis     109266785 (JUN)    05142 Chagas disease     109266785 (JUN)   09163 Immune disease    05323 Rheumatoid arthritis     109266785 (JUN)    05321 Inflammatory bowel disease     109266785 (JUN)   09165 Substance dependence    05030 Cocaine addiction     109266785 (JUN)    05031 Amphetamine addiction     109266785 (JUN)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     109266785 (JUN)    05418 Fluid shear stress and atherosclerosis     109266785 (JUN)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     109266785 (JUN)    04933 AGE-RAGE signaling pathway in diabetic complications     109266785 (JUN)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     109266785 (JUN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:ppad03000]     109266785 (JUN) Transcription factors [BR:ppad03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Jun     109266785 (JUN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 Fib_alpha FlaC_arch DUF3450 TFIIA NYD-SP28_assoc Motif Other DBs NCBI-GeneID:  109266785 NCBI-ProteinID:  XP_019304653 Ensembl:  ENSPPRG00000020728 UniProt:  A0A9V1FKL0 LinkDB All DBs Position Unknown AA seq 334 aa AA seqDB search MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVSGAGMVAPAVASAAGGSGSGGFSASLHSEPPVYANLSNFNPGA LSSGGGAPSYGAAGLAFPAQPQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPG ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag tccgagagcggtgcctacggctacagtaaccccaagatcctgaagcagagcatgaccctg aacctggccgacccggtgggcagcctgaagccgcacctccgggccaagaactcggacctc ctcacctcgcccgacgtggggctgctcaagctggcctcgcccgagctggagcgcctgata atccagtccagcaacgggcacatcaccaccacgccgacccccacgcagttcctgtgcccc aagaacgtgacagacgagcaggagggcttcgccgagggtttcgtgcgcgccctggccgaa ctgcacagccagaacacgctgcccagcgtcacgtcggcggcgcagccggtcagcggggcg ggcatggtggctccggcggtggcttccgcggcgggcggcagcggcagcggtggcttcagc gccagcctgcacagcgagccgccggtctacgccaacctcagcaacttcaacccgggcgct ctgagcagcggcggtggggcgccctcctacggcgcggccggcctggcctttcccgcgcag ccccagcagcagcagcagcccccgcagccgccgcaccacctgccccagcagatccccgtg cagcacccgcggctgcaggccctgaaggaggagccgcagacggtgcccgagatgcccggg gaaacgccgcccctgtcccccatcgacatggagtcgcaggagaggatcaaggcggagagg aagcgcatgaggaaccgcatcgctgcctccaagtgccggaaaaggaagctggagaggatc gcccggctggaggaaaaagtgaaaaccttgaaagcgcagaactcggagctggcgtccacg gccaatatgctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaac agtgggtgccaactcatgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system