KEGG   Proteus penneri: I6G31_00845
Entry
I6G31_00845       CDS       T07624                                 
Name
(GenBank) hypothetical protein
  KO
K23653  T3SS effector EspM
Organism
ppee  Proteus penneri
SSDB
Motif
Pfam: IpaB_EvcA DUF4460
Other DBs
NCBI-ProteinID: QPT34011
LinkDB
Position
complement(185544..186296)
AA seq 250 aa
MKSISNIFAIKRQNAENVFNNDNLKGYVKLLNNIKDIKNTPLIDIPSGCNGKKVSVNITE
ISRALLSKILKTYTPTEISSYRVSKENKEKSIKLLNKAYEKIDKDISGWWKDEKKILPSS
IINRTIDNLYKRDKVIINKETKQILFFLISKKFNLNLDENAAQSTMIQHLQDIPEVVKAI
DELGSSENSYLKYENYCLITEYIYNFLSENKVDFSKIKEAVKEIAERTLVTPKDELTQPS
PYYKHTLAFL
NT seq 753 nt   +upstreamnt  +downstreamnt
atgaaaagtatttcaaatatctttgcaattaaaagacaaaatgcagaaaatgtttttaat
aacgataatttaaaaggttatgtaaaacttttaaataatattaaagatattaaaaacacc
cctttaatagacattcctagtggttgtaatggaaagaaagttagtgtaaatattacagaa
attagtcgcgccttactatcaaaaatactaaaaacttatacacctacagaaatatcttct
tacagagttagtaaagaaaacaaagaaaaatcaataaaactattaaataaagcttatgaa
aaaatagataaagatatatcaggctggtggaaagatgaaaaaaaaattcttccttcttct
ataattaatcggactattgataatttatataaaagagataaagttattataaacaaagag
actaaacaaattttattttttttaatctctaaaaaatttaatctaaatttagatgagaat
gctgcgcaaagtacaatgatccaacatttacaagatatccctgaagtcgtaaaagcaata
gatgaattggggagctctgagaattcatatttaaaatatgaaaattattgtttaataact
gaatatatttataatttcttatcagaaaataaagttgatttttctaaaataaaagaagca
gttaaagaaatagctgaacgaacattggttactcctaaagatgaattaactcaaccttct
ccttattataaacatactcttgcttttttgtga

DBGET integrated database retrieval system