Prunus persica (peach): 18779605 Help Entry 18779605          CDS       T03092                                  Name (RefSeq) calmodulin-7   KO K02183   calmodulin Organism pper  Prunus persica (peach) Pathway pper04016   MAPK signaling pathway - plant pper04070   Phosphatidylinositol signaling system pper04075   Plant hormone signal transduction pper04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:pper00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     18779605    04070 Phosphatidylinositol signaling system     18779605    04075 Plant hormone signal transduction     18779605  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     18779605  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pper01009]     18779605   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pper04131]     18779605    03036 Chromosome and associated proteins [BR:pper03036]     18779605   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pper04147]     18779605 Protein phosphatases and associated proteins [BR:pper01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      18779605 Membrane trafficking [BR:pper04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     18779605 Chromosome and associated proteins [BR:pper03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      18779605 Exosome [BR:pper04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    18779605 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF-hand_FSTL1 EH EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 SAPC2_N UPF0154 DUF5580_M Dockerin_1 RNA_pol_Rpb4 EFhand_Ca_insen EF-hand_EFHB_C Caleosin MotA_activ FCaBP_EF-hand EF-hand_STIM1 SPEF2_C PA_Ig-like SurA_N_3 DUF6279 MecA_N Motif Other DBs NCBI-GeneID:  18779605 NCBI-ProteinID:  XP_007212203 UniProt:  M5WHW5 LinkDB All DBs Position G4:complement(21409082..21411415) Genome browser AA seq 149 aa AA seqDB search MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYEEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgatcagctcaccgacgaccagatctcagagttcaaggaggctttcagcctcttc gacaaggacggcgatggttgcatcactaccaaggagcttgggactgtcatgcgctcactt ggtcagaacccaactgaagctgagcttcaggatatgatcaatgaggttgatgctgatggg aatggaaccattgatttccctgagtttcttaacctgatggccaggaagatgaaggacact gattctgaggaggagctcaaggaagccttccgggtgtttgataaggaccagaatggcttc atttctgctgctgagcttcgtcatgttatgacaaatcttggtgagaagctgacagatgag gaagtggatgagatgattcgtgaggctgatgtggatggtgatgggcagatcaactacgag gagttcgtcaaagtcatgatggccaagtga

DBGET integrated database retrieval system