KEGG   Prunus persica (peach): 18788923
Entry
18788923          CDS       T03092                                 
Name
(RefSeq) 7-deoxyloganetin glucosyltransferase
  KO
K22706  (R)-mandelonitrile beta-glucosyltransferase [EC:2.4.1.354]
Organism
pper  Prunus persica (peach)
Pathway
pper00460  Cyanoamino acid metabolism
pper01100  Metabolic pathways
pper01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pper00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    18788923
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pper01003]
    18788923
Enzymes [BR:pper01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.354  (R)-mandelonitrile beta-glucosyltransferase
     18788923
Glycosyltransferases [BR:pper01003]
 Others
  Hydrophobic molecule
   18788923
SSDB
Motif
Pfam: UDPGT
Other DBs
NCBI-GeneID: 18788923
NCBI-ProteinID: XP_007227474
UniProt: M5Y2Y6
LinkDB
Position
G1:complement(42663519..42665471)
AA seq 483 aa
MSPVASKEKPHAVFVPFPAQGHINPMLQLAKLLNYKGFHITFVNTEFNHKRMLESQGSHA
LDGLPSFRFETIPDGLPPADADARRNLPLVCDSTSKTCLAPFEALLTKLNSSPDSPPVTC
IVADGVTSFTLDAAEHFGIPEVLFWTTSACGLMGYVQYYRLIEKGLTPFKDAKDFANGYL
DTEIDWIPGMKDVRLKDMPSFIRTTDPNDIMLHYMVSETERSKKASAIILNTFDALEQEV
VDALSTLLPPIYSIGPLQLPYSEIPSEYNDLKAIGSNLWAENTECLNWLDTKEPNSVVYV
NFGSTTVMTNEQLVEFSWGLANSKKPFLWIIRPGLVAGETAVVPPEFLEETKERGMLASW
CPQEQVLLHSAIGGFLTHSGWNSTLEALCGGVPLICWPFFAEQQTNVRYSCTQWGIGIEI
DGEVKRDYIDGLVRTLMDGEEGKKMRKKALEWKKLAEDATAPKGSSYLALENVVSKVLLS
PRD
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgagtccagttgcctccaaagagaagccacatgcagtttttgtacccttcccagctcag
ggtcacataaaccctatgctgcaattagccaagctcctcaactacaaaggcttccacata
acctttgtgaacacagagttcaaccacaagcgcatgcttgaatcccaaggttcccacgct
ctcgacggcctcccttcgtttcgattcgaaaccattcccgacggcctccctccggctgat
gccgatgccaggcgcaacttgcctttggtgtgcgattccactagtaaaacctgcttggca
cccttcgaggcgcttttgaccaagctcaactcttcacccgattcccctcctgtgacttgt
attgttgctgatggtgtcaccagcttcacccttgatgcagcagagcatttcgggatccca
gaagtgcttttctggacaactagtgcttgtggcttgatgggctacgttcagtattaccgt
ctcattgagaagggcctcactccttttaaagatgccaaggattttgcaaatgggtatttg
gatacagagattgattggatcccaggcatgaaggatgtcagattgaaggacatgcctagc
tttattagaaccacagacccaaacgacatcatgctgcattatatggtgtctgaaacagag
cgatccaaaaaggcttctgctattattttgaacacatttgatgccttggagcaagaagtt
gtggatgccctttccactttgctacctcctatttactccattggaccccttcagctacca
tacagcgagattccatcagaatacaatgatttgaaggcgatcggatcgaacctgtgggca
gagaatacagagtgccttaactggctggacaccaaagagcccaactctgtggtttatgtc
aactttggaagcaccacagtcatgacaaatgagcagctggttgagttttcttggggactt
gcaaatagcaagaagccatttttgtggatcatcaggcctggccttgttgctggagaaacc
gctgtggtgccgcctgagtttttggaggagaccaaagagaggggtatgttggcaagttgg
tgccctcaagaacaggttctgctccactcagccattggagggttcttgactcacagtggc
tggaactctaccctcgaggccttgtgtggcggagtgcctctcatctgctggcctttcttt
gcagagcagcaaacaaatgttaggtacagctgcacacagtggggcataggcattgagata
gacggggaagttaaaagagattacattgacggtcttgtgaggacattgatggatggagaa
gagggcaaaaagatgaggaagaaagcccttgaatggaagaagttggcagaggacgccact
gccccaaaagggtcgtcttacttggctctggaaaatgtggttagcaaagtgcttctttcc
ccaagagattag

DBGET integrated database retrieval system