KEGG   Pseudomonas putida F1: Pput_2905
Entry
Pput_2905         CDS       T00537                                 
Name
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K10617  p-cumic alcohol dehydrogenase
Organism
ppf  Pseudomonas putida F1
Pathway
ppf00622  Xylene degradation
ppf01100  Metabolic pathways
ppf01120  Microbial metabolism in diverse environments
ppf01220  Degradation of aromatic compounds
Module
ppf_M00419  Cymene degradation, p-cymene => p-cumate
Brite
KEGG Orthology (KO) [BR:ppf00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00622 Xylene degradation
    Pput_2905
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase
Other DBs
NCBI-ProteinID: ABQ79035
UniProt: A5W4H5
LinkDB
Position
complement(3296904..3297662)
AA seq 252 aa
MRLKDKVAIVTGAATGIGNAIVRSYLAEGAKVVIADVKGAEAAAAELGEDLALGVFADVS
DPDSTKQMAKAALDRFGKIDVLVNNAGIFTGLNYVPMESISVADWDKLYSVNVKGPWLCA
SAVSAAMREGGGGKIINIASVIAHIGAPFMLHYVSSKGAVAAMTRAMAREFATTKAGISV
NSISPGYTHSENALANAQQHEQFEGVSASMRAIDRPQVPADIAGVALWLASDEASYVNGQ
NIVVDGGIYMSL
NT seq 759 nt   +upstreamnt  +downstreamnt
atgagactgaaagacaaagtcgcaatcgtgactggtgcggcaaccgggattggcaacgct
atcgtgcgctcttaccttgctgagggtgcgaaggtggtcattgctgatgtgaaaggtgct
gaggcagccgcggcggaactgggtgaagacctagcgttgggtgtctttgccgacgtttcg
gatcctgatagcaccaagcagatggcaaaggcagcactggatcgcttcggcaagatcgac
gtgctcgtcaacaatgccggtatcttcaccggtctcaactatgtcccgatggaatcgatc
tcggttgcggattgggacaagctctacagtgtcaatgtcaaggggccctggctgtgcgcc
agtgcggtgtcggccgcgatgcgcgagggtggtggtggcaagatcatcaacatcgcctca
gtaatcgctcacatcggagcgcccttcatgttgcactacgtttccagcaagggcgctgtt
gcggcgatgacacgtgccatggcgcgcgaatttgcgacgaccaaggcagggatcagcgtc
aactccatctctcccggctacacccattcggaaaatgcgctcgcaaacgctcagcagcat
gagcagttcgagggcgtttctgcgtccatgcgggcaatcgatcgaccgcaagtgccggca
gatattgcgggagtggcgctttggttggctagcgacgaagcctcctacgtaaacgggcag
aacattgtggtggatggcggcatttacatgagcctctga

DBGET integrated database retrieval system