Phocoena phocoena (harbor porpoise): 136139021 Help Entry 136139021         CDS       T11058                                  Symbol CENPX Name (RefSeq) centromere protein X   KO K15360   centromere protein X Organism pphc  Phocoena phocoena (harbor porpoise) Pathway pphc03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:pphc00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     136139021 (CENPX)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:pphc03400]     136139021 (CENPX) DNA repair and recombination proteins [BR:pphc03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      136139021 (CENPX) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-X CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  136139021 NCBI-ProteinID:  XP_065754009 LinkDB All DBs Position 19:complement(12140126..12143505) Genome browser AA seq 79 aa AA seqDB search MEEIGAGFRKELVSKLLHLHFKDDKTKVSGDALQLMAELLKIFVVEAAIRSVRQAQAEDL AQVDVEQLEKVLPQLLLDF NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggaggaaatcggcgccggcttccggaaagagctggtgagcaagctgctgcacttgcat tttaaggacgacaagaccaaagtcagcggggacgcgctgcagctcatggccgagctgctc aagatcttcgttgtggaagcggccatccgcagcgtccggcaggcccaggcagaggacctg gcccaagtggacgtggaacagctggagaaggtgctgcctcagctgcttctggacttctag

DBGET integrated database retrieval system