Pseudomonas plecoglossicida: RK21_00701 Help Entry RK21_00701        CDS       T03646                                  Name (GenBank) anti-sigma-28 factor FlgM   KO K02398   negative regulator of flagellin synthesis FlgM Organism ppj  Pseudomonas plecoglossicida Pathway ppj02020   Two-component system ppj02025   Biofilm formation - Pseudomonas aeruginosa ppj02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:ppj00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     RK21_00701  09140 Cellular Processes   09145 Cellular community - prokaryotes    02025 Biofilm formation - Pseudomonas aeruginosa     RK21_00701   09142 Cell motility    02040 Flagellar assembly     RK21_00701  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:ppj02035]     RK21_00701 Bacterial motility proteins [BR:ppj02035]  Flagellar system   Flagellar assembly proteins    Others     RK21_00701 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM DUF2460 DUF1811 Motif Other DBs NCBI-ProteinID:  AJG12209 UniProt:  A0A0B5K1B2 LinkDB All DBs Position complement(768638..768901) Genome browser AA seq 87 aa AA seqDB search MRGNNAPGSAEKPAASQEAASGTSASGEAVHLSQEAQQLQKISDKLRDEPVVNSARVAQL KQAIADGSYQVDAGRVASKLLDFEAQR NT seq 264 nt NT seq  +upstreamnt  +downstreamnt gtgcgcggcaacaacgcgcctggcagcgccgaaaaaccggcagccagccaggaagcggcc agcggcaccagcgccagcggagaagcggtacacctcagccaagaggcccagcagttgcag aagatcagcgacaagctgcgcgacgagccagtagtcaacagcgcccgtgtggcccagttg aaacaggcgatcgccgatggcagctaccaggtcgatgccggccgggtcgccagcaaactg ctcgatttcgaagcccagcgctga

DBGET integrated database retrieval system