KEGG   Papilio polytes (common Mormon): 106103540
Entry
106103540         CDS       T07437                                 
Name
(RefSeq) methylenetetrahydrofolate reductase-like isoform X1
  KO
K25009  methylenetetrahydrofolate reductase [NAD(P)H] [EC:1.5.1.20]
Organism
ppot  Papilio polytes (common Mormon)
Pathway
ppot00670  One carbon pool by folate
ppot01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppot00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    106103540
Enzymes [BR:ppot01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     106103540
SSDB
Motif
Pfam: MTHFR Gemini_AL1
Other DBs
NCBI-GeneID: 106103540
NCBI-ProteinID: XP_013138777
LinkDB
Position
Unknown
AA seq 272 aa
MSELLRISDLIRNQDSFTFSFEVTPDVGEAELDKITLYPKFYSITWHALSHQCKDLNIAP
LKLANLLRQKHKHVLLNLSCNLMTKAYLNDLLPWLQEKGICNLFIVLGDSFNPNRSDFKN
SSEMISYIKTKTLDYFCIGVAGFPYDDCKITALKEKIDLGADFIISQAFFEANIYKNYLE
KCKDAKIDVPIIPGIFPFQSQKELDMFLKLCKVKVSEEFKMKLEGKSENVMDIIENLILD
LRNNLNVKHFHFFTINKLGITCDLVKKIQLSL
NT seq 819 nt   +upstreamnt  +downstreamnt
atgtctgaattattaagaattagcgacttaattagaaaccaagattcgtttacattttct
tttgaagtgaccccagatgtgggtgaagctgaacttgataagattacactttacccaaaa
ttttattctataacttggcatgctctgagccatcagtgtaaagatttaaatattgctcca
ttaaaattagcaaacttgctaaggcaaaaacataaacatgttttattaaatttatcgtgt
aatcttatgaccaaagcttatttaaatgacttactcccatggcttcaagagaagggaatt
tgcaatctgtttatagttttaggagattctttcaatcccaatagatctgacttcaaaaat
tcctctgaaatgatttcctatataaaaacgaaaacattggactatttttgtattggtgtt
gcgggctttccatacgatgattgcaaaataacagcattaaaagaaaaaatagatcttgga
gctgattttataatttcacaggcatttttcgaagcaaatatttataagaattatcttgaa
aaatgtaaagatgcaaaaatagacgtgcccataatacccgggatatttccttttcagtct
caaaaagaattggatatgttcttaaagttgtgtaaggttaaagtaagtgaagaatttaag
atgaaattagaaggaaaatcggaaaacgtgatggatattatagaaaatcttatactcgat
ttacgtaataatttgaatgtgaaacatttccattttttcacaataaataaacttggaata
acttgtgacttagtgaaaaaaattcaattatcattataa

DBGET integrated database retrieval system