KEGG   Pan paniscus (bonobo): 100969410
Entry
100969410         CDS       T02283                                 
Symbol
TP53AIP1
Name
(RefSeq) p53-regulated apoptosis-inducing protein 1 isoform X2
  KO
K13773  p53-regulated apoptosis-inducing protein 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04115  p53 signaling pathway
pps04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100969410 (TP53AIP1)
   04115 p53 signaling pathway
    100969410 (TP53AIP1)
SSDB
Motif
Pfam: TPIP1
Other DBs
NCBI-GeneID: 100969410
NCBI-ProteinID: XP_003819925
Ensembl: ENSPPAG00000031699
UniProt: A0A2R9ANI0
LinkDB
Position
11:complement(123748770..123757797)
AA seq 86 aa
MGSSSEASFRSAQASCSGARRQGPGRGDQSLSVMPPNGRAQTHTPGWVSDLLVLGAQVHG
GCRGIEALSVSSGSWSSATVWILTVQ
NT seq 261 nt   +upstreamnt  +downstreamnt
atgggatcttcctctgaggcgagcttcagatctgctcaagcttcctgcagtggggccagg
aggcagggcccgggcaggggagaccagagcctctcggtgatgcctccgaatggcagggct
cagacacacacaccgggctgggtttcagatctcttagttttgggtgcccaagttcacgga
gggtgccggggaatagaagctctgtcagtctcatctggatcttggtcctcagcaactgtc
tggatcctgacagtgcagtaa

DBGET integrated database retrieval system