KEGG   Pan paniscus (bonobo): 100972630
Entry
100972630         CDS       T02283                                 
Symbol
MRAP
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04927  Cortisol synthesis and secretion
pps04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:pps00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    100972630 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100972630 (MRAP)
SSDB
Motif
Pfam: MRAP FixQ
Other DBs
NCBI-GeneID: 100972630
NCBI-ProteinID: XP_008975972
Ensembl: ENSPPAG00000002893
UniProt: A0A2R8Z7E5
LinkDB
Position
21:18665550..18679537
AA seq 172 aa
MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHSIVIAFWVSLAAFVVLLFLILLYM
SWSGSPQMRNSPKHHQTCPWSHGLNLHLCIQKCLPCHREPLATSQAQASSVEPGSRTGPD
QPLRQESSSTLPLGVFQTHPTLLWELTLNGGPLVRSKPSEPPPGDRTSQLQS
NT seq 519 nt   +upstreamnt  +downstreamnt
atggccaacgggaccaacgcctctgccccatactacagctatgaatactacctggactat
ctggacctcattcccgtggacgagaagaagctgaaagcccacaaacattccatcgtgatc
gcattctgggtgagcctggctgccttcgtggtgctgctcttcctcatcttgctctacatg
tcctggtccggctccccgcagatgaggaacagccccaagcaccaccaaacatgcccctgg
agtcacggcctcaacctccacctctgcattcagaagtgcctgccgtgccacagggaaccc
ctggcaacctcacaggctcaggcgagctcagtggagccagggagcagaactggccctgac
cagccgctacgacaggagagctcctccaccttgcccctcggggttttccagacccatccc
actctcctctgggaattgaccctcaatgggggtcccctcgtcaggagcaagcccagcgag
cctccccctggagacaggacctctcaattgcagagctga

DBGET integrated database retrieval system