KEGG   Pan paniscus (bonobo): 100972975
Entry
100972975         CDS       T02283                                 
Symbol
TNFRSF8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8 isoform X1
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100972975 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pps04050]
    100972975 (TNFRSF8)
   04090 CD molecules [BR:pps04090]
    100972975 (TNFRSF8)
Cytokine receptors [BR:pps04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100972975 (TNFRSF8)
CD molecules [BR:pps04090]
 Proteins
  100972975 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 100972975
NCBI-ProteinID: XP_003822108
Ensembl: ENSPPAG00000033492
UniProt: A0A2R9AXI5
LinkDB
Position
1:10813111..10893005
AA seq 595 aa
MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPTGLFPTQQCPQ
RPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVN
SCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPT
PVSPATSSASAMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDC
RKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRICECRPGMICATSATNSCARC
VPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENAEAPASTSPTQSSLVDSQA
SKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLAVVVGSSAFLLCHRRACRKRIRQKL
HLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPIAEELGLMSQPLMETCHNVGAAYL
ESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGL
AGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK
NT seq 1788 nt   +upstreamnt  +downstreamnt
atgcgcgtcctcctcgccgcgctgggactgctgttcctgggggcgctacgagccttccca
caggatcgacccttcgaggacacctgtcatggaaaccccagccactactatgacaaggct
gtcaggaggtgctgttaccgctgccccacggggctgttcccgacacagcagtgcccacag
aggcctactgactgcaggaagcagtgtgagcctgactactacctggatgaggccgaccgc
tgtacagcctgcgtgacttgttctcgagacgacctcgtggagaagacgccgtgtgcgtgg
aactcctcccgtgtctgcgaatgtcgacctggcatgttctgttccacgtctgccgtcaac
tcctgtgcccgctgtttcttccattctgtctgtccggcagggatgattgtcaagttccca
ggcacggcgcagaagaacactgtctgtgagccggcttccccaggggtcagccctgcctgt
gccagcccagagaactgcaaggaaccctccagtggcaccatcccccaggccaagcccacc
ccagtgtccccagcaacctccagtgccagcgccatgcctgtaagagggggcacccgcctc
gcccaggaagctgcttctaaactgacgagggctcccgactctccctcctctgtgggaagg
cctagttcagatccaggtctgtccccaacacagccatgcccagaggggtctggtgattgc
aggaagcagtgtgagcccgactactacctggacgaggccggccgctgcacggcctgcgtg
agctgttctcgagatgacctcgtggagaagacgccgtgtgcatggaactcctcccgcatc
tgcgaatgtcgacctggcatgatctgtgccacatcagccaccaactcctgtgcccgctgt
gtcccctacccaatctgtgcagcagagacagtcaccaagccccaggatatggctgagaag
gacaccacctttgaggcaccacccctggggacccagccggactgcaaccccaccccagag
aatgccgaggcgcctgccagcaccagccccactcagagctcgctggtggactcccaggcc
agtaagacgctgcccatcccaaccagcgctcccgtcgctctctcctccacggggaagccc
gttctggatgcagggccagtgctcttctgggtgatcctggtgctggctgtggtggtcggc
tccagtgccttcctcctgtgccaccggagggcctgcaggaagcgaattcggcagaagctc
cacctgtgctacccggtccagacctcccagcccaagctagagcttgtggattccagaccc
aggaggagctcaacgcagctgaggagtggtgcgtcggtgacagaacccatcgcggaagag
ctagggttaatgagccagccactgatggagacctgccacaacgtgggggcagcctacctg
gagagcctgccgctgcaggatgccagcccggccgggggcccctcgtcccccagggacctt
cctgagccccgggtgtccacggagcacaccaataacaagattgagaaaatctacatcatg
aaggctgacaccgtgatcgtggggactgtgaaggctgagctgccggagggccggggcctg
gcggggccagcagagcccgagttggaggaggagctggaggcggaccataccccccactac
cccgagcaggagacagaaccgcctctgggcagctgcagcgatgtcatgctctcagtggaa
gaggaagggaaagaagaccccttgcccacagccgcctctggaaagtga

DBGET integrated database retrieval system