KEGG   Pan paniscus (bonobo): 100993436
Entry
100993436         CDS       T02283                                 
Symbol
RAB6D
Name
(RefSeq) ras-related protein Rab-6D
  KO
K07895  Ras-related protein Rab-6C
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100993436 (RAB6D)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:pps04031]
    100993436 (RAB6D)
Membrane trafficking [BR:pps04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab GTPases
    100993436 (RAB6D)
GTP-binding proteins [BR:pps04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab6/41 [OT]
    100993436 (RAB6D)
SSDB
Motif
Pfam: Ras Roc Arf SRPRB CPT
Other DBs
NCBI-GeneID: 100993436
NCBI-ProteinID: XP_034810063
LinkDB
Position
2B:29009755..29012600
AA seq 254 aa
MSAGGDLGNPLRKFKLVFLGEQSVAKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDG
TIGLRLWDTAGQERLRSLIPRYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTERGSDVI
ITLVGNRTDLADKRQVSIEEGERKAKGLNVRFIETRAKAGYNVKQLFRRVAAASPGMEST
QDRSREDMSDIKLEKPQEQPVSEGGCSCYSPMSSSTLPQKPPYSFIDCSVNIGLNLFPSL
ITFCNSSLLPVSWR
NT seq 765 nt   +upstreamnt  +downstreamnt
atgtccgcgggcggagacctcgggaatccgctgaggaaattcaagctggtgttcctgggg
gagcaaagcgttgcaaagacatctttgatcaccagattcatgtatgacagttttgacaac
acctatcaggcaacaattggcattgactttttatcaaaaactatgtacttggaggatgga
acaatcgggcttcggctgtgggatacggcgggtcaggaacgtctccgtagcctcattccc
aggtacatccgtgattctgctgcagctgtagtagtttacgatatcacaaatgttaactca
ttccagcaaactacaaagtggattgatgatgtcagaacagaaagaggaagtgatgttatc
atcacgctagtaggaaatagaacagatcttgctgacaagaggcaagtgtcaattgaggag
ggagagaggaaagccaaagggctgaatgttaggtttattgaaactagggcaaaagctgga
tacaatgtaaagcagctctttcgacgtgtagcagcagcttcgccgggaatggaaagcaca
caggacagaagcagagaagacatgagtgacataaaactggaaaagcctcaggagcaacca
gtcagcgaagggggttgttcctgctactctcccatgtcatcttcaacccttcctcagaag
cccccttactctttcattgactgcagtgtgaatattggcttgaaccttttcccttcatta
ataacgttttgcaattcatcattgctccctgtctcatggagatga

DBGET integrated database retrieval system