KEGG   Pan paniscus (bonobo): 117979374
Entry
117979374         CDS       T02283                                 
Symbol
RAB6C
Name
(RefSeq) LOW QUALITY PROTEIN: ras-related protein Rab-6C
  KO
K07895  Ras-related protein Rab-6C
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    117979374 (RAB6C)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:pps04031]
    117979374 (RAB6C)
Membrane trafficking [BR:pps04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab GTPases
    117979374 (RAB6C)
GTP-binding proteins [BR:pps04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab6/41 [OT]
    117979374 (RAB6C)
SSDB
Motif
Pfam: Ras Roc Arf
Other DBs
NCBI-GeneID: 117979374
NCBI-ProteinID: XP_034810090
LinkDB
Position
2B:complement(30288815..30291915)
AA seq 253 aa
MSAGGDLGNPLRKFKLVFLGEQXAKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDGT
IGLRLWDTAGQERLRSLIPRYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTERGSDVII
TLVGNRTDLADKRQVSIEEGERKAKGLNVTFIETRAKAGYNVKQLFRRVAAASPGMESTQ
DRSREDMSDIKLEKPQEQPVSEGGCSCYSPMSSSTLPQKPPYSFIDCSVNIGLNLFPSLI
TFCNSSLLPVSWR
NT seq 762 nt   +upstreamnt  +downstreamnt
atgtccgcgggcggagacctcgggaatccgctgaggaaattcaagctggtgttcctgggg
gagcagnttgcaaagacatctttgatcaccagattcatgtatgacagttttgacaacacc
tatcaggcaacaattggcattgactttttatcaaaaactatgtacttggaggatggaaca
atcgggcttcggctgtgggatacggcgggtcaggaacgtctccgtagcctcattcccagg
tacatccgtgattctgctgcagctgtagtagtttacgatatcacaaatgttaactcattc
cagcaaactacaaagtggattgatgatgtcagaacagaaagaggaagtgatgttatcatc
acgctagtaggaaatagaacagatcttgctgacaagaggcaagtgtcaattgaggaggga
gagaggaaagccaaagggctgaatgttacgtttattgaaactagggcaaaagctggatac
aatgtaaagcagctctttcgacgtgtagcagcagcttcgccgggaatggaaagcacacag
gacagaagcagagaagacatgagtgacataaaactggaaaagcctcaggagcaaccagtc
agcgaagggggttgttcctgctactctcccatgtcatcttcaacccttcctcagaagccc
ccttactctttcattgactgcagtgtgaatattggcttgaaccttttcccttcattaata
acgttttgcaattcatcattgctccctgtctcgtggagatga

DBGET integrated database retrieval system