KEGG   Paenibacillus psychroresistens: EHS13_00010
Entry
EHS13_00010       CDS       T06328                                 

Gene name
dnaN
Definition
(GenBank) DNA polymerase III subunit beta
  KO
K02338  DNA polymerase III subunit beta [EC:2.7.7.7]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03030  DNA replication
ppsc03430  Mismatch repair
ppsc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    EHS13_00010 (dnaN)
   03430 Mismatch repair
    EHS13_00010 (dnaN)
   03440 Homologous recombination
    EHS13_00010 (dnaN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ppsc03032]
    EHS13_00010 (dnaN)
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_00010 (dnaN)
Enzymes [BR:ppsc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     EHS13_00010 (dnaN)
DNA replication proteins [BR:ppsc03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     EHS13_00010 (dnaN)
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     EHS13_00010 (dnaN)
SSDB
Motif
Pfam: DNA_pol3_beta DNA_pol3_beta_2 DNA_pol3_beta_3
Other DBs
NCBI-ProteinID: QGQ99892
UniProt: A0A6B8RVJ4
LinkDB
Position
1495..2637
AA seq 380 aa
MKLTILKHQLNEAIQHVSKAISSRTTIPILNGVKIDATHQGVTLTASDTDISIQCFVPLE
ENGLQIIQIMKIGSVVLPAKFFIEIIRKLPAEEIEIELLQNFQTIIRSGSSEIQMVGLDA
EEYPLLPVIEQNKTISMASDLLKAMIKQTAFAVSTTETTPILTGVLWSLADQKLKLIACD
RHRLATRETNMDVSTDQQFNNIVISGKTLNELNKILPDQNSLVDIVVADNQILFRMQKIL
FYSRILDGTYPDTTKLIPQTFQTELTVNARNFTDSIDRAYLLSREDKTNIVKMIMHEDET
IEISSSSSELGKVTETIETTHISGDLLKISFNSKYMLDALKVLDTEFIKLSFTGAMSPII
IQPDEGISLLQLILPYRTTN
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgaaattaaccattctcaaacatcaactaaacgaagccattcaacatgtatcaaaggct
atatcttcaagaacaacaattcccattctcaacggcgtcaaaatagatgcaacacaccaa
ggtgtaaccctcacagcaagtgatacagatatatctattcaatgctttgtccctttagaa
gagaacggtttacaaattatccaaataatgaaaataggcagtgtagtattgcctgctaaa
ttttttatcgaaataatacgaaaattaccagctgaagaaattgaaattgaattattgcag
aattttcaaacaatcatccgttccggatcctcagaaatccaaatggtaggcttggatgct
gaagaatatcctctcttacctgttatagaacagaacaaaacgatttcaatggcaagtgat
ttattaaaagctatgatcaaacaaactgcatttgctgtatctacaacggaaacaacaccc
attctaaccggcgtcctctggagcttagctgatcagaaattaaaactaatagcttgtgat
cgtcatagattagcaacaagagaaaccaatatggatgtctctacagaccaacaatttaat
aatattgttatctcaggcaagaccctgaatgaattgaataaaatattaccagatcaaaat
tcattggttgatattgttgtagcggataatcaaatcttattccggatgcaaaagattctt
ttttactcacgtatattggacgggacatatcccgatactactaagcttattccgcaaacc
tttcaaacagaactaaccgttaatgccagaaattttacagactcaatagatcgtgcatac
ttgctttccagagaagacaaaaccaatattgtaaaaatgatcatgcatgaagatgaaaca
atagagatatcttcgagctcatcggaattaggtaaagtaacggaaaccattgaaacaaca
catatttcaggtgatttattaaagatatcttttaactcaaaatatatgctggatgcactt
aaagtcttagatacagaatttataaagctaagttttacaggagcaatgagcccgataatt
attcaacctgatgaaggaatcagcctgctacaattaattcttccttatcgaactacaaac
taa

KEGG   Paenibacillus psychroresistens: EHS13_01385
Entry
EHS13_01385       CDS       T06328                                 

Gene name
holB
Definition
(GenBank) DNA polymerase III subunit delta'
  KO
K02341  DNA polymerase III subunit delta' [EC:2.7.7.7]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03030  DNA replication
ppsc03430  Mismatch repair
ppsc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    EHS13_01385 (holB)
   03430 Mismatch repair
    EHS13_01385 (holB)
   03440 Homologous recombination
    EHS13_01385 (holB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ppsc03032]
    EHS13_01385 (holB)
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_01385 (holB)
Enzymes [BR:ppsc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     EHS13_01385 (holB)
DNA replication proteins [BR:ppsc03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     EHS13_01385 (holB)
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     EHS13_01385 (holB)
SSDB
Motif
Pfam: DNA_pol3_delta2 AAA AAA_5 AAA_32 IN_DBD_C DNApol3-delta_C
Other DBs
NCBI-ProteinID: QGQ93663
UniProt: A0A6B8RDP0
LinkDB
Position
279890..280870
AA seq 326 aa
MSFATIVGQDRVKRLLQNGLKHETLSHAYIFSGPSGSGRRQMALTLAQAVYCLEMKDDAC
GTCLNCRKVAHQNHPDLHWIEPDGASLKIEQIRELQKQFAYRSTTSQTKVYVLQNADRMT
TQAANSLLKFLEEPTSDVLAILIAENGHALLPTIQSRAQWVPFTPLGVQELSQKLIAEGL
SATLVLPAVHIVAGLDAARELIQGNWFAEARNVMIQLVMEALTSYPAALLSIQQKVIKAE
WVEHLPIFLDLSILWFKDMVHFICGREDSMIYLDRIDWIRQHAFSREIQYWVACMEHTIE
LQKRLRFNANAQLAMEKWIIDIQRGD
NT seq 981 nt   +upstreamnt  +downstreamnt
atgtcatttgctacaatagtaggtcaagatcgcgtaaaacgtttattgcagaatggttta
aagcatgagacgctgtcgcatgcatatatttttagtggacctagtggctctgggcgcaga
cagatggcgctcacactagcacaagcagtttattgtttggaaatgaaagatgatgcttgc
ggtacatgcttgaattgccgcaaagtagctcatcagaaccatccagacttacattggatt
gaaccagatggggctagcttgaagatcgaacaaattcgtgagctgcagaagcaatttgct
tatcgttcgaccacctcgcagactaaagtatacgtacttcagaatgcggaccgaatgact
actcaagcggctaacagcttgcttaaatttctagaggaaccaacatccgacgttttggcg
attctaattgctgagaatggacatgctcttctgcctaccattcaatcacgtgcccaatgg
gttccttttaccccactaggggttcaagagctatctcaaaagctaattgcagaggggctt
tctgcgactttagtattacctgcggttcatattgttgcaggcttagatgctgctagagag
cttattcaggggaattggtttgccgaagcacgaaatgtaatgatacaattggttatggag
gcgttgaccagttatccggcagcactgctatccatccaacaaaaggtaataaaagctgaa
tgggtcgagcatttaccaatatttcttgatttgtcgattctttggtttaaagatatggta
cattttatctgcggacgagaagatagtatgatctatttagatcgaatagactggataaga
cagcatgcattttctcgcgaaattcaatattgggttgcctgtatggaacataccatagaa
ttgcaaaagagactccgatttaatgctaacgcacagttagctatggagaagtggatcatt
gacatacaaaggggggattaa

KEGG   Paenibacillus psychroresistens: EHS13_03955
Entry
EHS13_03955       CDS       T06328                                 

Definition
(GenBank) 3'-5' exonuclease
  KO
K02342  DNA polymerase III subunit epsilon [EC:2.7.7.7]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03030  DNA replication
ppsc03430  Mismatch repair
ppsc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    EHS13_03955
   03430 Mismatch repair
    EHS13_03955
   03440 Homologous recombination
    EHS13_03955
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ppsc03032]
    EHS13_03955
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_03955
Enzymes [BR:ppsc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     EHS13_03955
DNA replication proteins [BR:ppsc03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     EHS13_03955
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     EHS13_03955
SSDB
Motif
Pfam: RNase_T DNA_pol_A_exo1 DUF5051 RNase_H_2 Pox_ser-thr_kin CAF1
Other DBs
NCBI-ProteinID: QGQ94119
UniProt: A0A6B8RCZ9
LinkDB
Position
834177..834797
AA seq 206 aa
MALINEITVFDFETTGLSAEKDQVIEMAAIRVANGQVVGEFSTLIQYDGKLSPKIIELTG
IHDEELKHGFDEVTAFKIFNRFIGNSVIVAHNAAFDLGFLHHTLMRLAKRSFNNSFIDTL
TISRERTVFPYKLTDLCARYNIELIGAHRALSDVYGCWHLYEALSKEVKIEDYINKLGYM
SKYGPPKWAPDYAVLQAQENRYEDRR
NT seq 621 nt   +upstreamnt  +downstreamnt
atggctttgattaacgaaataaccgtgtttgattttgaaacgacgggcttaagcgctgaa
aaggatcaggtcattgaaatggctgcgattcgggttgcgaatggacaggttgttggtgaa
ttcagtaccttgattcaatacgatggcaagctgtctcccaaaattatcgagctaacaggg
atacatgatgaagaattaaagcatggctttgatgaagtgactgcttttaaaatattcaat
cgtttcatcggaaatagtgtgattgtcgctcataatgctgcctttgatttaggctttcta
catcatactttaatgcgtctggcgaaacgttccttcaataactcttttatcgatacattg
acgatcagtcgcgagcggacggtttttccttataagcttacggatttatgtgcaagatat
aatattgaattgattggcgctcatcgtgctctaagtgatgtttatggctgctggcattta
tatgaagctttaagcaaagaagtgaagattgaagattacatcaataagctaggctatatg
tcgaaatatggaccacccaagtgggcgccggactatgcggtattgcaggcccaagaaaat
cgttatgaagatcgcagataa

KEGG   Paenibacillus psychroresistens: EHS13_12780
Entry
EHS13_12780       CDS       T06328                                 

Gene name
holA
Definition
(GenBank) DNA polymerase III subunit delta
  KO
K02340  DNA polymerase III subunit delta [EC:2.7.7.7]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03030  DNA replication
ppsc03430  Mismatch repair
ppsc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    EHS13_12780 (holA)
   03430 Mismatch repair
    EHS13_12780 (holA)
   03440 Homologous recombination
    EHS13_12780 (holA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ppsc03032]
    EHS13_12780 (holA)
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_12780 (holA)
Enzymes [BR:ppsc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     EHS13_12780 (holA)
DNA replication proteins [BR:ppsc03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     EHS13_12780 (holA)
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     EHS13_12780 (holA)
SSDB
Motif
Pfam: DNA_pol3_delta HTH_37 HTH_38 iSTAND
Other DBs
NCBI-ProteinID: QGQ95694
UniProt: A0A6B8RIX2
LinkDB
Position
2864207..2865226
AA seq 339 aa
MDYKTAAKGITQGNSLPIYVCYGTEKYLQQEFIQHVIDKLIEPDQRSFAVSRYDLSETSL
DTVLDDAETMPFLADKKIVIAKNALFFTGAKESTKVEHRIERLLEYLKSPVDYAIIIFVV
DADKLDERKKIVKALKESQSAIPFLPLSVDELSRWISRRADKWGVTFEDGAIDKFILYTG
AQLQILTSELEKLSLFVGPNGCITGELIGQLVVRSAEQNVFILMDEIVKQRLDNALSIFH
DLLKQKEEPIKILLLIARQFRIMLQIKELEQQGYSQQQIAGQIGAHPYAVKLASEQGRSY
SLAKLSGLLSQLGDLDYRMKSGKVEKALGLELFILEIPS
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggattataaaacagcagccaaggggattacccaaggcaattctttacctatctatgta
tgctatggcacggaaaaatatttgcagcaggaatttattcaacatgtaattgataaactg
attgaaccagatcaaagatcatttgctgtaagtcgctatgacttaagtgaaacgagcctg
gatactgtgctagatgatgctgaaactatgccatttctggcagataagaaaattgtaatt
gccaagaatgcccttttttttacaggcgctaaagaaagcactaaagtcgagcatcggatt
gaacgacttttggagtatctgaaatcacctgtcgattatgcaataattatctttgtagtg
gatgcggacaagctggatgaacgaaagaaaatcgtcaaagcacttaaagaaagtcagagc
gcaattccttttttaccgttatctgtagatgagctttctcgttggataagtcgtagagca
gataaatggggagttacctttgaagatggagccatcgacaaatttattctttatacaggc
gctcagctgcaaattcttacatcggagctcgagaagctctcgctttttgttggtcctaat
ggctgtatcactggtgaattaattgggcagcttgtcgtgcggagtgcggagcagaatgtt
tttatcctcatggatgaaattgttaaacaacgcttggataatgccttatcgatctttcat
gatttattaaagcagaaagaagagccgattaaaatcttattgctgatagctcgccaattc
cgaattatgctgcaaattaaagagctagagcagcaaggctactcccagcagcaaattgct
ggtcaaatcggggctcacccttatgcagtcaagctagcctctgagcaggggcgcagctac
tccttagcgaagctcagcgggttattatcgcaattaggagatctggactatagaatgaaa
agtggcaaggttgagaaggcattaggattagagctgttcatccttgaaattccaagctga

KEGG   Paenibacillus psychroresistens: EHS13_15960
Entry
EHS13_15960       CDS       T06328                                 

Definition
(GenBank) PolC-type DNA polymerase III
  KO
K03763  DNA polymerase III subunit alpha, Gram-positive type [EC:2.7.7.7]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03030  DNA replication
ppsc03430  Mismatch repair
ppsc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    EHS13_15960
   03430 Mismatch repair
    EHS13_15960
   03440 Homologous recombination
    EHS13_15960
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ppsc03032]
    EHS13_15960
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_15960
Enzymes [BR:ppsc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     EHS13_15960
DNA replication proteins [BR:ppsc03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     EHS13_15960
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     EHS13_15960
SSDB
Motif
Pfam: DNA_pol3_alpha PHP RNase_T DNA_pol3_finger DNA_pol3_a_NI DNA_pol3_a_NII HHH_6 DNA_pol_A_exo1 RNase_H_2 tRNA_anti-codon HHH_3
Other DBs
NCBI-ProteinID: QGQ96267
UniProt: A0A6B8RKB6
LinkDB
Position
3568212..3572540
AA seq 1442 aa
MIKKRERFELLLQQALFSSEIINGHFAEGYIDQVEVSRSNSQWTFTLAKKQILPSDIYQI
FCKTIRDKFAHIAQIDFIVKYDLAEVSSDSLINTYWAHCSEWIKKAVPSINGYIRDAKYE
LNGDVITVSILEEIGMEIVKKKSGELWIQRYFRDFFAREFTVRFNVTESNEIELKRVQYF
QQNEQEDKMFTQNLVSAIEKDVEASKATEGELKLMVGYEIRDIPVPIQQIVEEEKKITMQ
GMVFGIEVKVLKTGTTLYQFYITDFTDSLMVKAFVKTKEDLKIYNLIANGKWIKVRGKVE
YDRFGQPPELMLIPNDINEIVAPMDRMDNAEHKRVEFHLHTTMSTMDGITPIGEYVKTAA
RWGHKAIAVTDHSGVQSYPDANKAGKKHGVKIIYGVEANVVNDSIPIVLNSIDLDLESTT
YVVFDIETTGLSVMNNRIIEIAGVKMQDGKVIGEFSSFVNPHEIIPYNITQLTHITDDMV
KDAPEIESVLPQFAQFIGDAVLVAHNARFDMGFIQANCKTLGMPELMNPVLDTLELARFL
FPSMKNHRLNTLADKFKISLDNHHRAIADAEALGHILSSLIKETSERNIRNLHHLNDYAG
IDLRNTRPFHCCIYAKNAIGKKNLYKLISISHTEHYNKVPSIPKSKLIQLREGLHINSGC
DKGEFFEAVLNKSLEEAEEVAAFYDVLEIQPIGNYMHLVDRGFVGSRESLELTVRRICEM
GDRLNKPVIATGNVHYLHPREKINRDITIFGITGFSPLKDQNKPDVHLRTTEEMLREFQF
LGESKAMEVVVSNTSKLADEFEEISLFPKKGGPADNGLFSPIFEGADDEIRETCYRTAAS
LYAEPLPEIVIARLEKELKPIIQYGFSANYLISEKLVKKSNEDGYLVGSRGSVGSSFVAT
MLGISEVNPLPPHYICRACKYNEFFTDGSIPSGFDLPSKPCPNCGENLRGEGQDIPFETF
LGFKGDKVPDIDLNFSGEYQAIAHNYTKILFGPENVFRAGTIGTVADKTAFGYVKKYEED
KGKSWRNAELNRLASGCTGVKRSTGQHPGGIVVVPDYIDVEEITPVQFPADDQSSEWKTT
HFDYHAFEENFLKLDILGHDDPTMMRMLQDLTGIDPTTIPMNDQKVMSIFNSTEAIGVEP
HQIRSPVATFGVPEMGTKFVRQMLQETKPTSFADLLQISGLSHGTGVWLGNAQELIKKGT
CDIKTVIGCRDDIMLYLIYKANMDASLAFKITESVRKGRGLTEEWKDDMKKHKVPAWYID
SCEKIEYMFPKAHAAAYVISAVRTAYFKVYHPIAYYATYFSVRAEDFDVELFCKGYDAIL
RKLLEIESKGFQALPKERAMISILEMGLEMTSRKLNFKSIDIYKSDASRFIIEGDSLIPP
FSSVAGVGENAAKLIAVAKEYGDFLSIEDFQQKSKVSKTVIELLNALGCFGAMPESNQLS
LF
NT seq 4329 nt   +upstreamnt  +downstreamnt
atgattaaaaaacgcgaacgatttgaattattgctgcaacaagcacttttttccagtgag
atcattaatgggcattttgctgaaggatacatagaccaggttgaggttagtcgcagtaac
agtcaatggacctttacgcttgctaagaaacaaatcctaccttctgacatttaccaaatc
ttctgtaaaacgatccgtgataagtttgctcacattgctcagattgactttatcgtgaaa
tatgatttagcagaagtttcgtcagatagcttaataaatacctattgggcgcattgcagt
gaatggatcaaaaaggcggtgccgtcgattaatggttatattagagatgccaaatatgag
ctcaatggcgatgtgattacggtaagtattttagaagaaattggcatggagatagtcaaa
aagaaaagcggagaattatggatccagcgttattttcgtgatttttttgctcgagaattt
accgtacgttttaatgtgactgaatctaacgaaattgagttaaaaagagtgcaatacttt
caacaaaacgagcaagaagataaaatgtttacgcagaacttagtttccgcgattgagaag
gatgtggaagcttccaaagctactgaaggcgaattaaagctcatggtaggttatgaaatc
agagatattccggtacccattcaacaaattgttgaagaagagaagaaaattacgatgcaa
ggcatggtttttggaattgaggtcaaggtgctcaaaaccggtacaaccctctatcaattt
tatataacggatttcacggactccttaatggtgaaggcctttgtcaaaacaaaagaagat
ctaaaaatatataatttaatagcaaatggcaagtggataaaggttcgcggcaaagtggag
tatgatcgttttgggcagccgccagagctgatgcttattcctaatgatatcaatgaaatc
gtcgcaccaatggaccgtatggataatgctgaacacaaaagggtcgaatttcatttacac
acgactatgagcactatggatggaattacacctataggtgaatatgttaaaacagcagct
cgctggggacataaagctattgcggttaccgatcatagcggtgtgcaatcctatccagat
gcgaataaggcagggaagaaacatggagttaagatcatttatggggttgaagctaatgtt
gtaaatgactctattcctattgtacttaactctattgacttggatttagagagtacaacc
tatgttgtttttgatatagaaacgacaggtctgtctgttatgaacaatcgaattattgaa
atcgctggagtgaaaatgcaagatggcaaggtgattggtgagttctcaagctttgttaat
ccgcacgaaattattccttataatattacgcagctaactcatatcaccgacgatatggta
aaggatgccccagaaatcgaatctgtgcttccgcaatttgcccagtttattggagacgcc
gtattagttgcccataatgctagatttgatatgggttttatacaagccaattgcaaaaca
ttagggatgccagaactcatgaatccggtcctagatacattggagcttgcacgtttttta
tttcctagcatgaagaaccaccgtttaaacacattggcagataaatttaagattagcttg
gataatcatcatcgggcgattgcggatgctgaagcacttggccacattttatcaagttta
atcaaagagacatcagagcgtaatatccgtaatttgcatcatttgaacgattacgcaggg
attgatttgcgtaatacacgcccgtttcactgctgtatttatgcaaaaaatgcgattggc
aaaaagaatttatataagttaatttctatttctcataccgagcattacaacaaagtacct
tcgattcccaagagtaaattaattcaattaagagaaggtctgcacattaattcaggctgt
gataaaggcgagttttttgaagctgtgcttaataaatccttagaggaagcggaagaagtt
gccgcattctatgatgttctggaaattcagcctattggcaactatatgcatttagtggac
agagggtttgtcggcagcagggaaagtctggagctgacggttcgccggatttgcgagatg
ggagatcggctgaataagccggtcattgctacgggcaatgtccattatctccatccacgc
gaaaaaataaatcgcgatattaccatctttgggataacagggtttagccctttgaaggac
cagaataaaccagatgttcaccttcgtacaacggaggaaatgctgcgtgagttccaattt
cttggcgagtccaaggcgatggaagtcgtggtaagcaatacttctaaactagcagatgaa
tttgaagagatatcgttgtttcctaaaaaaggcggccctgctgataatggcttattttcc
ccaatctttgaaggtgcagacgatgaaatccgcgaaacctgttaccgaacagcggcttcg
ctttatgcagagccattaccggaaattgttatagcccgtctagaaaaggaattgaaaccg
attattcaatacggtttctccgccaactatttaatttcagagaagctagttaaaaaatca
aatgaagatggttacttggttggatctcggggatcagttggatcttcttttgtagcgact
atgctcggtatatcggaagtaaatcccttgccgcctcattatatttgcagagcttgtaaa
tataatgaattctttacggatggcagtattccaagcggatttgatttacctagtaagcca
tgccccaattgtggagaaaacctaagaggagaaggtcaggatattccttttgaaactttt
cttggctttaaaggcgataaagttcccgatattgacttgaacttttctggggaatatcaa
gctattgctcataattatacaaaaattttgttcggtccggaaaatgtttttcgtgcagga
accattggtactgtggcggataagacggcatttggttatgtgaagaagtacgaagaggat
aaagggaaaagctggcgtaatgcggagttaaaccggcttgcttcaggctgtacaggagtt
aaacgcagcacaggccagcatcctggcggaattgtagttgttccggattatatcgatgta
gaagagattaccccagtgcagttccctgcggatgatcaaagctcagaatggaagacaact
cattttgactaccatgcattcgaagaaaatttccttaaactcgatatcctgggtcatgac
gatccgactatgatgcgaatgctgcaggacttaacaggaattgatccaacaaccattccg
atgaatgatcaaaaggttatgagtatttttaattcaactgaggcaattggggttgaacct
caccaaatccgttcaccagttgctaccttcggagtacccgagatgggcactaaattcgtt
cgccaaatgcttcaagaaacaaagccaacctcatttgccgatttattgcaaatatctggt
ttgtctcatggtacaggcgtatggcttgggaatgctcaggagttaattaaaaagggtact
tgcgatattaaaacggttatcggctgtcgggatgacatcatgctttatttgatttataaa
gctaatatggacgcaagcttagctttcaaaataacggaaagtgtacgtaaaggtagaggg
ttaaccgaggaatggaaagacgatatgaaaaagcataaagtacctgcttggtatatcgat
tcctgtgaaaaaattgagtatatgtttcctaaggcgcatgccgccgcttatgttatttcc
gcagtacgaacggcttattttaaggtgtaccatcctattgcctattacgcgacctacttt
agcgttcgtgccgaagattttgatgtggagttattctgtaaagggtatgacgcaattcta
cgaaaattattggagattgaatcaaaaggctttcaagctttgcctaaagaaagagcgatg
atttccattctggaaatgggcttggagatgacgtcacgcaagttgaatttcaaatccatt
gatatctataaatcggatgcatcgcgctttattatagaaggagattcgctaattccacct
ttttcatcggtagcaggtgttggtgaaaatgccgctaagctaatagcggtggcgaaggag
tatggtgacttcttatcaatagaagactttcagcaaaaatccaaagtttccaaaacagta
attgagcttctaaatgcgttaggctgctttggggcaatgcctgaatccaaccagctttca
ttattttaa

KEGG   Paenibacillus psychroresistens: EHS13_20045
Entry
EHS13_20045       CDS       T06328                                 

Definition
(GenBank) 3'-5' exonuclease
  KO
K02342  DNA polymerase III subunit epsilon [EC:2.7.7.7]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03030  DNA replication
ppsc03430  Mismatch repair
ppsc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    EHS13_20045
   03430 Mismatch repair
    EHS13_20045
   03440 Homologous recombination
    EHS13_20045
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ppsc03032]
    EHS13_20045
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_20045
Enzymes [BR:ppsc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     EHS13_20045
DNA replication proteins [BR:ppsc03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     EHS13_20045
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     EHS13_20045
SSDB
Motif
Pfam: RNase_T DNA_pol_A_exo1 DUF5051
Other DBs
NCBI-ProteinID: QGQ97012
UniProt: A0A6B8RMU5
LinkDB
Position
complement(4412649..4413257)
AA seq 202 aa
MLNEMDLTIWDFETSGLDPLKEQVIEMAALKIHKGIITGSFNCFVKHDKQLSQKITELTG
IVDDDLKDGFDEDIAFKMLKQFMGNNIIGAHNATFDLAFLHHSRMRLFNQSFSNSFIDTL
TIARDRVPFPHKLTDLTTRHNIEMDTAHRALADVYGCYKLLQHYDKEESVEPWINRLGYV
KKWGPATWYPEHAKPFEQGYKN
NT seq 609 nt   +upstreamnt  +downstreamnt
atgttaaatgaaatggacttaaccatctgggacttcgagacttcgggtcttgatccatta
aaagagcaagtaatcgaaatggctgctctcaagattcacaagggcatcataacaggctca
ttcaattgcttcgtgaagcacgacaaacaattaagccaaaagataacggaactcactgga
atcgttgatgatgatctaaaggatggctttgacgaagacattgcatttaaaatgctcaag
cagttcatgggcaacaacatcataggtgcgcacaatgcaacttttgaccttgctttcctg
caccattctcgcatgcggctattcaaccaaagcttcagcaatagtttcatagacacgctg
acgattgctagagatcgagtgccgttccctcacaaactcactgaccttactacaaggcat
aacattgagatggacacagcccacagagcccttgctgatgtttatggctgttacaagctt
ctgcaacattacgataaagaggaatctgtagagccttggatcaatcggctagggtacgtt
aaaaagtggggaccagcgacttggtatcccgaacatgcaaaaccatttgagcaaggatat
aaaaactga

KEGG   Paenibacillus psychroresistens: EHS13_22365
Entry
EHS13_22365       CDS       T06328                                 

Definition
(GenBank) 3'-5' exonuclease
  KO
K02342  DNA polymerase III subunit epsilon [EC:2.7.7.7]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03030  DNA replication
ppsc03430  Mismatch repair
ppsc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    EHS13_22365
   03430 Mismatch repair
    EHS13_22365
   03440 Homologous recombination
    EHS13_22365
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ppsc03032]
    EHS13_22365
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_22365
Enzymes [BR:ppsc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     EHS13_22365
DNA replication proteins [BR:ppsc03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     EHS13_22365
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     EHS13_22365
SSDB
Motif
Pfam: RNase_T DUF5051 DNA_pol_A_exo1 RNase_H_2 PP_kinase_C Polysacc_deac_2
Other DBs
NCBI-ProteinID: QGQ97435
UniProt: A0A6B8RPF1
LinkDB
Position
complement(4901517..4902260)
AA seq 247 aa
MKEPKPPSGMWQLYKMGGITPAINSMFNPQNAQQMAFIRSIMKEQRQNSLYDVTLNDLHA
VVFDLETTGFSPYNGDEIISIGAVVVEGRDVKSEETFYSNVNPKRNIPTVVEELTGITNK
MGSEAPELIQALRRFLEFVQKRILIAHGTGHDKQFLNSALWKTSKTNLTHRVLDTMMIAK
WLHPKRRDFGLDSLLDHYEISIDPAQRHHALGDSLMTANLWCKFMKEMENREVNNLGDLY
AHLSHMA
NT seq 744 nt   +upstreamnt  +downstreamnt
atgaaggaacctaagccccctagcgggatgtggcagctctataaaatgggcggcattact
cctgcaattaattcgatgtttaatccgcagaatgcacagcaaatggccttcatccgatct
atcatgaaggagcaacgccaaaattcattatatgatgtaactttgaatgatctgcatgct
gtggtgtttgatctggaaactactggattctccccttataatggggatgaaattatctca
attggcgctgtggttgtggaaggcagagatgttaagtcagaagagaccttctatagcaat
gtgaatcccaaacgcaacattcctacagttgttgaggagcttacggggataactaataag
atgggatcagaagcaccggaattaatccaagccttacgcagatttttagaatttgtccag
aagcgaatattgattgcgcatggaacagggcatgataagcagtttttgaactcggcttta
tggaaaacctcaaaaacgaatctcactcaccgggtcttggatacgatgatgattgccaaa
tggctgcatcctaaacgtagggattttggactggattcgttattggatcattacgagatt
tcgatagatccagctcagcgacatcatgcgttgggggattctttaatgacagccaatctt
tggtgtaagtttatgaaggaaatggaaaacagagaagtcaataatttgggcgatctatat
gctcatttaagtcacatggcttag

KEGG   Paenibacillus psychroresistens: EHS13_24405
Entry
EHS13_24405       CDS       T06328                                 

Definition
(GenBank) DNA polymerase III subunit alpha
  KO
K02337  DNA polymerase III subunit alpha [EC:2.7.7.7]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03030  DNA replication
ppsc03430  Mismatch repair
ppsc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    EHS13_24405
   03430 Mismatch repair
    EHS13_24405
   03440 Homologous recombination
    EHS13_24405
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ppsc03032]
    EHS13_24405
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_24405
Enzymes [BR:ppsc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     EHS13_24405
DNA replication proteins [BR:ppsc03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     EHS13_24405
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     EHS13_24405
SSDB
Motif
Pfam: DNA_pol3_alpha DNA_pol3_finger PHP HHH_6 tRNA_anti-codon tRNA_anti_2 DUF655 DUF2288 SSB
Other DBs
NCBI-ProteinID: QGQ97806
UniProt: A0A6B8RQZ3
LinkDB
Position
complement(5345183..5348737)
AA seq 1184 aa
MDNFVHLHVHSEYSLLDGAARIDSLTAKAAELGMSSLALTDHGVMYGAIPFYKACLKHGI
KPIIGCEMYFTSGSLHTKASRQDQPIYHLLLLAKNHIGYQNLMKLCSIAHLEGFHYKPRI
DLKHLALHSEGIICLSSCLGSEISQHLLHDRYEEAKLAAEKYQLIFEDDFYLELQDHGIY
EQKKVNLSMIRLSQETGIPLVVTNDVHYVLSEDHAMQDILLCIGTGKTVDDQDRMKFAST
QLYLKSGAEMAGLFAHAPGAMTNTAEIAAKCELKLEFGQSILPRFEPIPEGLSAGEYLKQ
LCLTGLEQRYGESEDWLNIEPREVLDQRLSYELSVIQTMGFSDYFLIVWDFIRYAHEQNI
AVGPGRGSSAGSLVAYVLKITDVDPIRYQLLFERFLNPERISMPDIDIDFSDERRDEVID
YVVDKYGAERVAQIITFGTMAAKGAIRDVGRVLNMPYHEVDRVAKMIPFQLGITLEEAIA
GSPELQALSHSHAKTAELLQIAMKVEGMPRHASTHAAGVVISNEPLTQYVPLQEGTVKTP
LTQYAMEHLESIGLLKMDFLGLRTLSIIERTQASIKSSFGEPLNFKKIPDNDPLTYEMLS
RGDATGVFQMESQGVRRVLKDLKPTEFEDIISVLALYRPGPMEFIPKYIQGKHKEIEVDY
PHESLIPILQTTYGIIVYQEQIMQIASKMAGFSLGESDVLRRAVSKKKREVLDQQRAHFV
AGSLQEGYSDEDAHKVYDMIVRFADYGFPRAHATAYGVIAFQTAYLRAHYPAHFMSSMLT
AVMGSHRKVAEYVDDCRRLQIKVLPPDVNESGMIFTPVKVDAEGTMVIRFGLAAIKNVGT
QAIDSIMKERLERPYDSLLDLCRRVDLRVCNKRVLESLLQAGAFDSLEGHRAQLLAILDA
TLEAAIKWKKERDELQLFLFGFDEEINWTIEYPEIRPFTIMQQLELERELLGIFLSGHPL
DAYETLLQTSGVSAMIHLPELPDLSEVIVAGMVISVKTIVTKKGMQMAFIELEDRVEKVE
VVLFPETWKRFNSFIQKGELILVKAKLQLQDEDIKLLADQVVAMNNPDQQDQLLLQFQRT
TYSKQQSRNVEPKPRSTPPVEKPKPASSKQQRVFVKISEAYENQTILARLKAALQDHSGS
LQVVLFYEREQKMVALNNQYNVKPSEDFIRSLEALMGSGAIKVQ
NT seq 3555 nt   +upstreamnt  +downstreamnt
atggataattttgtccatcttcatgtacatagtgaatatagcttattggatggtgctgca
cgaattgatagcttaacagcaaaagcagcggaattaggtatgtcttcgttagctttaacg
gatcatggtgtcatgtacggggcaatccctttttataaagcttgtttgaagcatggaatt
aaaccgattattggctgtgaaatgtattttacaagtggttctctacatactaaagcaagc
aggcaagaccagccgatctatcacctgctgttattggcgaagaatcatatcggctaccag
aatttaatgaagctttgttccattgctcatttagaaggctttcactataaaccaagaata
gacttgaagcatcttgccttacattccgaaggaatcatttgtttaagctcgtgcctagga
agtgagatttcgcagcatctgctgcatgatcgttatgaggaagctaagctggcggctgag
aaatatcagcttatttttgaggatgatttctatttggagctgcaggatcacggaatctat
gagcaaaagaaagtgaatttgtcgatgatccgcctaagccaagaaacggggatcccgcta
gttgtgaccaatgatgtgcattatgtattatctgaggatcatgcgatgcaagacattctt
ctctgtattggcacagggaaaaccgttgatgatcaggacaggatgaaattcgcttcgacg
cagctttatctgaaaagtggagcggaaatggctggattgttcgcacatgcaccgggggcc
atgacgaatacggccgagattgctgcaaaatgtgagcttaagctggagtttggccaatcg
attctgcctagattcgaacccattcccgagggattatcagcgggtgaatatttaaaacag
ctgtgtttaacagggctggaacaacgttatggcgaaagcgaagattggttaaatatagaa
ccgcgtgaagtactggatcaacgtctcagctatgaattaagtgtcattcaaactatgggg
ttttccgattatttcctaatcgtttgggattttattcgttatgcacatgaacagaatatt
gctgtaggaccaggacgtggttcatctgcgggtagtttagtcgcttacgttctgaagatt
actgacgtcgatcccattcgttatcaattattgtttgagcgcttccttaatccagaacga
attagcatgccggatatcgatattgatttcagcgatgagcggcgagatgaagtcatcgat
tatgtcgtggataaatatggggcagagcgtgtagcccagattattacattcggtaccatg
gcagccaagggggctattcgtgatgtcggcagggtattgaatatgccttaccatgaggta
gatcgcgtagctaagatgatcccctttcagctaggcattactcttgaagaggcaatcgca
ggcagtccggaattgcaagctttaagccatagccatgctaagacagccgagctcctgcaa
attgccatgaaggtagaaggtatgccgcgtcacgcttccacacatgcagcaggcgtcgtg
atatcgaatgaacctttaactcaatatgtccctttgcaggaaggcacggtgaagacaccg
ttgactcaatatgctatggagcatctagagagcattggtctattaaaaatggatttcttg
ggcttgcgcacgctttcgattattgaacgaacgcaggcatcgattaaaagctcgtttggc
gagcccttgaacttcaagaagataccggacaatgatcccttaacctatgaaatgttaagt
cgtggtgacgcaacaggcgtttttcaaatggagtctcaaggtgttagacgtgtgcttaag
gacttaaagccaacggaattcgaggatattatttcagtgttagcactttatcgtcctggg
ccaatggaattcattcctaaatatattcaaggcaagcataaagagattgaagtggattat
ccacatgaatctctcattcccattctgcagacaacctatgggatcattgtttatcaggaa
caaatcatgcaaatcgcttctaagatggcaggtttctctctgggagagtcagatgtgctt
cgccgtgcggtcagcaagaaaaagcgtgaggtgctggatcaacaacgggcgcattttgtc
gccggcagcttgcaagagggctattcagatgaggatgcgcataaagtatacgatatgatt
gtccgcttcgctgattatggctttccgcgagctcatgcgacggcttatggcgtgattgct
tttcaaaccgcttatttacgggcacattatccagctcatttcatgagctccatgctgaca
gccgttatggggagccatcgtaaggttgctgagtatgtcgatgattgccgtcgtttgcag
atcaaggtattgccaccggatgtcaacgaaagcgggatgatttttacgccggtgaaggtg
gatgctgaaggaacaatggtcatccgatttggtctagctgcaattaagaatgtaggtact
caagcgattgattccattatgaaggaacgattagaacggccatacgatagcttgcttgat
ttatgccgccgtgtggatttgagagtttgcaataaacgggttttagaatccttgctgcaa
gcaggtgcctttgattccttggagggccatcgcgcccagctgttagctatcttggatgca
accttggaagcggcgatcaagtggaaaaaggagcgggatgagctgcagctgtttttgttt
ggttttgatgaggaaatcaattggacgattgaatatccggaaattcgcccatttacgatc
atgcagcaattggagctagaacgagaattgctcggtatttttctctcaggccatccattg
gatgcctatgaaacactgctgcaaaccagcggtgtttccgcaatgattcatttgccagag
ctcccagacctcagtgaagttattgtcgcaggaatggtcatatcagtgaaaactatagtc
accaaaaagggcatgcaaatggcttttattgagcttgaggatcgagtggagaaagtcgaa
gtggtcttattccctgaaacctggaagagatttaatagctttatccaaaagggtgaatta
atcttagtcaaggcaaagctgcagctgcaggacgaggacatcaaattattggcagatcaa
gttgtggcaatgaataatccggatcagcaggatcagctgcttttgcagtttcaacgcaca
acttactccaaacaacaatcacgtaatgtggaaccgaaaccgaggtcgactcccccagtg
gaaaagcccaagcctgcaagcagtaagcagcagcgtgtttttgtgaaaattagtgaagcc
tatgagaatcaaactattcttgcaaggctaaaagcagctcttcaggatcatagcggttcc
ttgcaggttgtacttttctacgagagggaacagaagatggtcgcactcaataaccaatat
aacgttaagccatctgaggattttattcgctcccttgaagcattgatgggaagcggagct
attaaagtgcagtag

KEGG   Paenibacillus psychroresistens: EHS13_32365
Entry
EHS13_32365       CDS       T06328                                 

Gene name
dnaX
Definition
(GenBank) DNA polymerase III subunit gamma/tau
  KO
K02343  DNA polymerase III subunit gamma/tau [EC:2.7.7.7]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03030  DNA replication
ppsc03430  Mismatch repair
ppsc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    EHS13_32365 (dnaX)
   03430 Mismatch repair
    EHS13_32365 (dnaX)
   03440 Homologous recombination
    EHS13_32365 (dnaX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ppsc03032]
    EHS13_32365 (dnaX)
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_32365 (dnaX)
Enzymes [BR:ppsc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     EHS13_32365 (dnaX)
DNA replication proteins [BR:ppsc03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     EHS13_32365 (dnaX)
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     EHS13_32365 (dnaX)
SSDB
Motif
Pfam: DNA_pol3_delta2 AAA DNA_pol3_gamma3 RuvB_N TIP49 AAA_30 AAA_5 AAA_22 Rad17 ResIII AAA_16 AAA_14 AAA_19 ABC_tran AAA_assoc_2 AAA_18 DUF6395 CIS_TMP RNA_helicase Mg_chelatase DELLA TsaE PIF1 Sigma54_activ_2 AAA_28 AAA_33
Other DBs
NCBI-ProteinID: QGQ99225
UniProt: A0A6B8RUE2
LinkDB
Position
complement(7218723..7220522)
AA seq 599 aa
MAHIALYRTWRPQRFQDVVGQKHIIQTLQNSLKENRLTHAYLFSGPRGTGKTTAAKILAK
AVNCERGPAPEPCNECSSCIRITSGAVLDVVELDAASNRGVDEIRDIRDKVKYAPTEVRQ
KVYIIDEVHMLTTEAFNALLKTLEEPPAHVMFILATTEPHKIPATIISRCQRFDFRKVSL
EEQVARLEFVCTQENVEIDLDAMQYIARLSEGGMRDAISLLDQVVSYSGKRITYAEVVAM
TGDVAADQFRKLAEAMQAKDIGLALELIDGFMQEGKSADKCIESLIHYFRDILLIKMMPN
SQVVTDRILDPAAFTEISAAFSRPEIFAMIEILNHYQVEMKYSAQPQTLFEVAIMKICSA
SSEVASDTMKAQPGARVSSNELASLKQKLGQLEQQLQRLLQSGVSTAASSSAPAQNNNSA
QTSRAQSPQQQSSNTMTTSAQPSTSSAPAAAVKRSSVAMDSYLRSVDSADHKQVKLKWSS
VLSQVKDRKITIHAWLTDGEPASIHDDTVLLAFNSAMHRETTEKPANKQLIEQVMTEVFG
QPMRFSSMMKKDWNEARSEMVAPVEEMVLEPEEPGVVKEEWIHEAIQLFGEDMVTIKED
NT seq 1800 nt   +upstreamnt  +downstreamnt
atggcgcatattgcattatatcgaacttggcgaccgcaacgttttcaagatgtcgtcgga
caaaagcatattatccaaaccttacagaactcccttaaggagaataggctaactcatgct
tatttgtttagtgggcctcgaggaacagggaagaccacagctgctaagatcttggctaag
gctgtaaactgtgaacgaggaccagcaccagagccttgcaacgaatgttcttcctgtata
aggataacaagtggtgcagtactggacgttgttgagctagatgctgcctctaatcgcggg
gtagatgagattcgtgacattcgtgataaagtcaaatatgccccgacggaggttcgtcag
aaggtatatattattgatgaggtccacatgcttactacagaggcatttaatgctctgctt
aagacattggaagaaccacctgcacatgttatgtttattctagcaacaacagagcctcac
aaaattcctgcaacaattatttctagatgtcagcgatttgattttcgcaaagtttcttta
gaggaacaagtcgcaaggttggaatttgtatgtactcaagagaatgtcgagattgatcta
gatgcgatgcaatatatcgcaagattatccgaaggcggcatgcgcgatgctataagcttg
ctcgatcaagtcgtttcttattcaggcaaacgcattacatatgccgaagttgtcgcaatg
acaggtgatgtggctgcggatcaatttcgtaagctagcagaagctatgcaggctaaggat
atagggcttgctttggaattaatcgatggattcatgcaggaaggcaaaagcgcggacaaa
tgcatcgaaagcctgattcattattttcgagacattttacttatcaaaatgatgccgaat
tcacaggttgtcacagatcgtattcttgacccggcagcatttacagagatttctgcagct
ttcagtcgtccagagatattcgcaatgattgaaattttgaaccattatcaggttgaaatg
aagtactccgctcagccacaaaccttatttgaagtagctatcatgaaaatttgtagtgcg
tctagcgaggtggcttcagatacaatgaaggcacaaccaggtgcgagggttagctcaaat
gagcttgcatcgctaaaacagaagctgggtcaattggaacaacagctacagcgcttgctg
cagtctggagtatctacagctgctagctcatcggctcccgcgcagaacaacaattctgca
cagacatcaagagcacaatctccacaacagcaaagctctaatactatgacaacatcagca
cagccttcaacatcgtctgctcctgcagctgcagtgaaacgatcatccgttgcaatggac
agctatttgcgcagtgtagattcagccgatcacaaacaagtgaagctgaaatggagctcg
gtattaagccaagtcaaagatcgtaaaataacgatacacgcttggctcacagatggtgaa
cctgcttctattcatgacgatactgttcttttggcgtttaacagtgccatgcatcgtgaa
acaaccgagaaacctgctaataaacaattaattgaacaagtaatgaccgaggtttttggt
cagcctatgcgattctccagtatgatgaagaaagattggaatgaagctaggtcagaaatg
gtcgctccagttgaagagatggtgcttgagcctgaagaaccaggtgtggttaaggaagaa
tggattcatgaagcgatacaattgtttggcgaagatatggtcacaataaaagaagattaa

DBGET integrated database retrieval system