Paenibacillus psychroresistens: EHS13_15210 Help Entry EHS13_15210       CDS       T06328                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ppsc  Paenibacillus psychroresistens Pathway ppsc01100   Metabolic pathways ppsc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppsc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EHS13_15210   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EHS13_15210 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QGQ96127 UniProt:  A0A6B8RJW9 LinkDB All DBs Position 3430283..3430549 Genome browser AA seq 88 aa AA seqDB search MEWRKFKMNSVEQQFIDLINAELNVVIDQTHFKMNLDDLGVNSLVFVQLVVAIESHFDIE FENIQLLNTNFSDANSIIRYIEKRLEEV NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggaatggaggaaattcaaaatgaattcagtggaacaacaatttatagatttgataaat gcagaattaaatgttgtaatcgatcaaactcacttcaaaatgaacttggatgaccttggt gttaattcattggtctttgttcaattggttgttgctatagagtcgcattttgacatcgaa tttgagaacattcaattactcaatactaatttttccgatgctaattccataattcgttat atagaaaaaaggttagaggaggtttaa

DBGET integrated database retrieval system