KEGG   Photinus pyralis (common eastern firefly): 116177511
Entry
116177511         CDS       T07438                                 
Name
(RefSeq) cytochrome P450 306a1 isoform X1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
ppyr  Photinus pyralis (common eastern firefly)
Pathway
ppyr00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:ppyr00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    116177511
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:ppyr00199]
    116177511
Enzymes [BR:ppyr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     116177511
Cytochrome P450 [BR:ppyr00199]
 Cytochrome P450, animal type
  CYP306 family
   116177511
SSDB
Motif
Pfam: p450 DASH_Dad3
Other DBs
NCBI-GeneID: 116177511
NCBI-ProteinID: XP_031352358
LinkDB
Position
Unknown
AA seq 501 aa
MGLMIYILIFAILLLLGMYRLLRSKNLPPGPWGLPVLGYLPFLDPKAPHETLTTLSRKYG
KIYGLHLGSVYTIVLSDATAISSAFSMDKLTGRAPLYLTHGIMGGYGLICAEGSMWRIHR
KFAAKFLRLFGATKSARAATDSLTEVIIREVHDCVNVSHQLATPAYRFLLQVIGDECEPI
DPLAHLQHAIGSVMCQLVFGKTWSRDDPTWLWLQHTQEEGTKAIGVAGPLNFFPFLRYIP
RFSKVVRFLLDGKHKTHQLYRELIEQERKNVQADESPQNVIQAFLREINTTSDKEYFTFQ
QFYHLLADIFGAGLDTTLTTLRWQLLYMAACPKIQGEIREEVDRVLQDRPPTIEDIPLLP
LTRASIAETQRIRSVVPVGIPHATLDEVNLLGYRIPKGTMVVPLQWAVHMDPTIWEKPDE
FNPRRFLNEEQRFAKPKQFMPFQTGKRMCIGEDLAIMILFFFTASILQRFEICASGDVDL
VGEIGITLTPRKQAIRFVSRR
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgggtctaatgatttatatattaatcttcgcaattcttctactgcttgggatgtaccgg
ttgttgcgctctaagaacttaccaccaggaccgtggggcttacccgttctgggttattta
ccctttctcgatcccaaagctcctcacgaaacgttgacgacgctctcacgcaaatatggc
aaaatttatggcctgcatcttggcagcgtttacaccatcgtactttcggatgcgacggcc
atttcatcggctttctcaatggataagcttaccggaagggcgccactttatctaacccac
gggattatgggtggctatggacttatttgcgcagaaggaagtatgtggcgtattcatcga
aagtttgcggcaaaatttttgaggttgtttggagcaaccaaatcggccagagcggctaca
gactcgttgacggaagtaattataagagaagtgcacgattgtgttaatgtaagtcatcaa
ctcgcaactcccgcttacagatttctgttgcaggtcattggggatgaatgtgaacccatt
gaccctctagcacatttacaacatgccataggatcagtaatgtgccagttggtttttgga
aaaacgtggagtagagatgatcccacttggttgtggcttcaacatactcaggaggaggga
accaaggctattggggttgctggtccactaaactttttcccatttttaagatacattcca
cgatttagcaaggtcgtgcgttttctactagatgggaagcataagactcaccaactgtat
cgcgagctgatagagcaggagcggaaaaatgtccaagccgatgagtcaccccaaaatgtc
attcaagccttcctacgcgaaataaataccacgtccgacaaagagtattttacttttcag
caattttatcatttacttgcagacatttttggtgccggcttagatactactttgaccacg
ttacgctggcaattgctttacatggcagcctgtcctaaaattcagggtgagattcgtgaa
gaggtggatcgtgtacttcaagatcgcccccctacgatagaagacatcccgctgcttccg
cttacgcgagcttccatcgccgaaacgcaaaggatccgttccgttgtacccgtcggcata
ccccacgcaactttggacgaggtcaatctgctcggttaccgcatccccaaaggcaccatg
gtggtaccattgcagtgggccgttcacatggacccgacaatttgggagaaacccgacgaa
tttaatccaagacgcttcttgaacgaggaacaacggtttgccaagcctaaacaatttatg
ccgtttcaaactgggaaaaggatgtgcatcggcgaggacttggcgatcatgattttgttc
ttctttaccgcctcaattctgcaacggttcgaaatttgcgcatctggcgatgtggatttg
gtgggcgaaataggaattacgctcacaccccgaaagcaagccattagatttgtttccaga
agatga

DBGET integrated database retrieval system