Metapseudomonas resinovorans: PCA10_54440 Help Entry PCA10_54440       CDS       T02708                                  Name (GenBank) hypothetical protein   KO K09892   cell division protein ZapB Organism pre  Metapseudomonas resinovorans Brite KEGG Orthology (KO) [BR:pre00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pre03036]     PCA10_54440 Chromosome and associated proteins [BR:pre03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     PCA10_54440 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB Asd-4 Matrilin_ccoil Motif Other DBs NCBI-ProteinID:  BAN51176 UniProt:  S6B1U2 LinkDB All DBs Position 6065880..6066089 Genome browser AA seq 69 aa AA seqDB search MEDAELHALTGKLELLIQRVEQLKAQNRLLLASEKAWREERAHLIEKNEMARLKVEAMIS RLKALEQDS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaagatgccgaactgcatgcactgacaggcaagctggaactcctgatccagcgtgtc gagcagctcaaggcccagaaccggctcctgcttgccagcgagaaggcctggcgtgaagaa cgcgctcatctgatcgaaaagaacgaaatggcccggctcaaggtcgaagcgatgatttcg cgcctgaaagccctggagcaggattcatga

DBGET integrated database retrieval system