KEGG   Poecilia reticulata (guppy): 103474986
Entry
103474986         CDS       T05149                                 
Symbol
mrap
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
pret  Poecilia reticulata (guppy)
SSDB
Motif
Pfam: MRAP PMT_4TMC
Other DBs
NCBI-GeneID: 103474986
NCBI-ProteinID: XP_008424552
LinkDB
Position
LG13:complement(27160264..27161744)
AA seq 124 aa
MFGSTSALLSRNRTASHFSKNDTVAVPGNSTSAPLYEWEYYLDYLDPVFVDESQLKYHKY
SIVIILWVSLAAFVGFLFLILNLMSLSVELPKINKSKIQRQHKTSAASPLADTGDGSDGC
LDPC
NT seq 375 nt   +upstreamnt  +downstreamnt
atgttcggatcgacttcggctcttctctctagaaacagaacagcaagccatttctccaaa
aatgacactgttgctgttccggggaactccaccagtgctcctctgtatgaatgggagtac
tacttggattatcttgatcctgtttttgtggatgagagccagctgaaataccataaatac
tcaattgtcataatactctgggtatctctggctgcttttgtgggatttctctttctcatt
ttgaacctaatgtctctcagtgtggagttgccaaagataaacaaatctaaaatccagcgt
caacacaaaacctcagcagcttcaccactggctgatactggagatggctccgatggctgt
ttggatccttgttga

DBGET integrated database retrieval system