Phodopus roborovskii (desert hamster): 127216866 Help Entry 127216866         CDS       T08852                                  Name (RefSeq) glutathione S-transferase Y1   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism prob  Phodopus roborovskii (desert hamster) Pathway prob00480   Glutathione metabolism prob00980   Metabolism of xenobiotics by cytochrome P450 prob00982   Drug metabolism - cytochrome P450 prob00983   Drug metabolism - other enzymes prob01100   Metabolic pathways prob01524   Platinum drug resistance prob05200   Pathways in cancer prob05204   Chemical carcinogenesis - DNA adducts prob05207   Chemical carcinogenesis - receptor activation prob05208   Chemical carcinogenesis - reactive oxygen species prob05225   Hepatocellular carcinoma prob05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:prob00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     127216866   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     127216866    00982 Drug metabolism - cytochrome P450     127216866    00983 Drug metabolism - other enzymes     127216866  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     127216866    05204 Chemical carcinogenesis - DNA adducts     127216866    05207 Chemical carcinogenesis - receptor activation     127216866    05208 Chemical carcinogenesis - reactive oxygen species     127216866   09162 Cancer: specific types    05225 Hepatocellular carcinoma     127216866   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     127216866   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     127216866  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:prob02000]     127216866 Enzymes [BR:prob01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      127216866 Transporters [BR:prob02000]  Other transporters   Pores ion channels [TC:1]    127216866 BRITE hierarchy Motif Pfam:  GST_C GST_N GST_C_3 GST_N_3 GST_C_2 GST_N_2 GST_C_6 Motif Other DBs NCBI-GeneID:  127216866 NCBI-ProteinID:  XP_051033698 LinkDB All DBs Position Unknown AA seq 218 aa AA seqDB search MPMILGYWNVRGLTHPIRLLLEYTDTSYEEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNL PYLIDGSHKITQSNAILRYIARKHNLCGETEEERIRVDIVENQVMDTRMQLIMLSYNPDF EKQKPEFLKTIPEKMKMYSEFLGKRPWFAGDKVTYADFLSYDILDQYRTLEPKCLDPFPN LKDFLARFEGLKKISAYMKTSRFLPKPIFSKMAHWCNK NT seq 657 nt NT seq  +upstreamnt  +downstreamnt atgcctatgatactgggatactggaacgtccgcggtctaacacaccccatccgcctgctc ctggaatacacagacacaagctatgaggagaagagatacaccatgggtgacgctccggac tttgacagaagccagtggctgaatgagaagttcaagctgggcctggacttccccaatctg ccctacttaattgatgggtcccacaagatcacccagagcaacgccatcctgcgctacatc gcccgcaagcacaacctgtgtggggagacagaggaggagaggattcgagtggacattgtg gagaaccaggttatggacacccgcatgcagctcatcatgctgagttacaacccggacttt gagaaacagaagccagagttcttgaagaccatccctgagaagatgaagatgtactctgag ttcctgggcaagcggccatggtttgcaggggacaaggtcacctatgcggatttcctttct tatgatattcttgaccagtatcgaacgttggagcccaaatgcctggatccctttccaaac ctgaaggacttcttggcccgctttgagggcctgaagaagatctctgcctacatgaagacc agccgcttcctcccgaaacctatattttcaaagatggcgcactggtgtaacaagtag

DBGET integrated database retrieval system